Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN JOSE DEL CABO MEXICO-2020: Landscape View Of A Wave Of Fog Settling Over

5s 4K UHD 29.97fps San Jose Del Cabo, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A serene home movie clip from 2020 capturing a misty landscape in San Jose Del Cabo, Mexico. A wave of fog rolls over the mountains and town, slowly settling like a soft blanket across the terrain. The atmospheric scene evokes quiet beauty and natural wonder, filmed with a cinematic eye. This vintage-style home movie footage offers a nostalgic, dreamlike view of nature’s quiet transformation, perfect for storytelling, travel content, or ambient visuals.

Clip Intelligence

Production use
Useful for a travel edit, documentary, agency mood reel, brand film, or social cut needing an aerial view of San Jose Del Cabo with fog over mountains, town blocks, golf greens, and resort-style buildings.
Edit role
The short runtime works as a quiet opener, location cutaway, or transition beat before moving into beach, resort, or street-level coverage from the same Mexico sequence.
Visual details
The frames show a hazy town below layered mountains, green fairway-like grounds, ponds or water features, white and red-roofed buildings, pale sky, muted early light, and no visible people.

Tags

fogunclearmountaintownsettlesblanketslandscapeviewwavesettlingmexicannatureSAN jose DEL cabo mexico2020cinematographybeautifullovefootagecinematic

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.265 (HEVC) MP4
File size
63 MB
Location
San Jose Del Cabo, Mexico
Year filmed
2020
Published
May 2020

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view over San Jose Del Cabo with green grounds, white buildings, small ponds, hazy mountains, pale sky, and no visible people at the opening frame.
The first frame sets the clip's wide elevated view of town and fog-softened mountains. (0:00)
San Jose Del Cabo appears in a broad aerial composition with red-roofed buildings in front, clustered town blocks beyond, layered mountains, fog, and no visible people.
This frame keeps the town and resort-area grounds visible beneath the low haze. (0:01)
Elevated view across a hazy Mexican town with golf-like greens and mountains.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.