Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

WINTER PARK COLORADO-2019: A Female Helper Kneeling Next To A Little Girl On Monkey Bars

6s 4K UHD 59.96fps Winter Park, Colorado, United States 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A young girl plays on monkey bars at a playground in Winter Park, Colorado, in 2019. A female helper kneels nearby, attentively watching and supporting her. The scene captures a candid moment of childhood play and supervision,. Bright colors and natural lighting highlight the joyful atmosphere of a winter day at the park. This vintage-style footage offers authentic, unscripted moments ideal for storytelling, family content, or nostalgic projects.

Clip Intelligence

Production use
Useful for a family travel edit, documentary insert, social cut, or brand film needing supervised kids activity in Winter Park, Colorado with visible harness gear and outdoor recreation context.
Edit role
A six-second cutaway or insert that can bridge a playground or ropes-course sequence, adding a child-and-helper beat between wider Winter Park activity shots.
Visual details
A young girl in a red harness stands near a female helper beside hanging safety gear, metal barriers, ropes, colorful padded posts, and other people in bright midday sun.

Tags

colorfulyellowkidsmonkey barsworkersfemalehelperkneelinggirlplaygroundpeoplewinter park colorado2019artbuyfootageabstracthome videodigital

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.264 MP4
File size
75 MB
Location
Winter Park, Colorado, United States
Year filmed
2019
Published
Jul 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

In Winter Park, Colorado, a female helper kneels near a young girl wearing a red harness beside ropes, barriers, and outdoor recreation equipment.
The opening frame shows the clearest helper-and-child supervision moment for a buyer. (0:00)
A young girl in a red harness stands in the foreground while the helper is cropped at the torso near hanging gear and barriers in Winter Park, Colorado.
This frame keeps the child and activity equipment visible while the helper moves higher in the composition. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.