Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2020: Family And Dog Playing Frisbee On Sandy Beach In Sunny

7s 4K UHD 59.96fps Los Cabos, Mexico 2020
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A young child and a dog play joyfully on a sun-drenched sandy beach in Los Cabos, Mexico, in 2020. The child throws a frisbee as the dog eagerly chases it across the shore, capturing a moment of carefree summer fun. This home movie footage exudes warmth and nostalgia, with golden sunlight and gentle waves in the background. The scene reflects family bonding and playful energy, perfect for evoking feelings of happiness and relaxation. Ideal for lifestyle, travel, or emotional storytelling projects.

Clip Intelligence

Production use
Useful for travel edits, family documentary scenes, brand films, or social cuts needing Los Cabos beach footage with a child, adult, dog, frisbee, open sand, and surf.
Edit role
A short lifestyle cutaway or transition beat for a beach sequence, moving from family play at the shoreline into cleaner ocean and sand coverage by the end of the clip.
Visual details
A child, an adult, and a dog with a red frisbee appear on a wide sandy beach, with blue ocean, white surf, pale dunes, strong sun, and people visible in the early frames.

Tags

beautifulcalmwarmchildpetseasadfamilydogplayingfrisbeesandybeachsunnyweatherholidaysLOS cabos mexico2020footageintroduction

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
7s
Codec
H.264 MP4
File size
81 MB
Location
Los Cabos, Mexico
Year filmed
2020
Published
Jun 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

An adult, a child, and a dog holding a red frisbee stand on the sand in Los Cabos, Mexico, with surf and dunes behind them.
This opening frame establishes the family beach play setup with the dog and frisbee visible. (0:00)
An adult and child remain near the left edge while a dog with a red frisbee faces the open beach and surf in Los Cabos, Mexico.
The frame keeps the human subjects and dog in view while showing the long empty shoreline. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.