Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2020: Aerial View Of Green Space And Buildings Of A City On The

6s 4K UHD 29.97fps Los Cabos, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial footage from 2020 captures a vibrant cityscape in Los Cabos, Mexico, showcasing lush green spaces nestled among modern buildings. The cinematic view highlights urban development against natural landscapes, offering a dynamic perspective of the region's architecture and environment. This home movie-style clip provides a nostalgic yet contemporary glimpse of the city, ideal for travel, lifestyle, or architectural storytelling.

Clip Intelligence

Production use
Useful for travel edits, documentary context, agency mood reels, brand films, or social cuts needing a 2020 aerial view of Los Cabos with coastline, residential buildings, green space, and hills in frame.
Edit role
The short aerial run works as an opener, geographic transition, or cutaway between beach, resort, and city material in a Los Cabos sequence.
Visual details
Frames show a coastal urban area with pale beach, ocean, hillside terrain, golf-course-like green space, roads, clustered homes, hotel or apartment blocks, and no visible people.

Tags

citybeachmountainsdaytimegreenaerialviewspacebuildingsbackgroundlandmarksLOS cabos mexico2020cinematicintrostunninghome moviebusiness

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
75 MB
Location
Los Cabos, Mexico
Year filmed
2020
Published
Jun 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

High aerial frame in Los Cabos, Mexico looking down over green space, roads, clustered homes, palms, and a dense light-colored burial-ground-like area, with no visible people.
This opening frame emphasizes the inland green space, neighborhood blocks, and roads before the coastline becomes dominant. (0:00)
Los Cabos aerial view with a long green fairway centered between sandy lots, residential buildings, curving roads, and palm trees, with no visible people.
This frame gives an overhead look at built development and managed green space near the coast. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.