Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2020: A Beautiful Sea On A Beautiful Sunny Day Perfect For

6s 4K UHD 29.97fps Los Cabos, Mexico 2020
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

This home movie captures crystal clear ocean waves lapping against the shore under a bright sun in Los Cabos, Mexico. The vibrant, sun-drenched scene features a perfect summer day with calm waters and a peaceful coastal atmosphere. Ideal for travel, nature, and lifestyle content, this vintage-style footage offers a nostalgic glimpse of a family-friendly beach destination. The natural beauty and serene mood make it perfect for documentaries, editorial pieces, and nostalgic storytelling.

Clip Intelligence

Production use
Useful for travel edits, documentary texture, agency mood reels, brand films, or social cuts needing a Los Cabos aerial view of pale green surf and bright sun reflections.
Edit role
The short runtime works as a water-texture cutaway, coastal transition, opening beat, or visual pause between beach and family moments in a Los Cabos sequence.

Tags

dronewavesseacrystal clear watersoceansunbeautifulsunnydayperfectswimmingfamilynatureLOS cabos mexico2020prointroductionnewb-roll

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
75 MB
Location
Los Cabos, Mexico
Year filmed
2020
Published
Jul 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Top-down view of pale turquoise water in Los Cabos, Mexico, with white foam clusters along the upper and lower edges and no visible people.
The opening frame establishes the clip as an overhead ocean texture with bright reflected sunlight. (0:00)
Overhead Los Cabos water surface with a broad white foam field across the top, smaller foam patches below, and no visible people.
This moment shows the repeating foam pattern spreading across the water surface. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.