Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Sky View Of Beautiful Ocean And Empty Beach (El Sargento la Ventana, 2020)

6s 4K UHD 29.97fps Ocean El Sargento la Ventana, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The calm waters stretch to the horizon under a clear sky, with no people in sight, creating a peaceful and contemplative atmosphere. This vintage-style footage offers a nostalgic glimpse of coastal tranquility, ideal for projects exploring nature, travel, or quiet moments by the sea.

Clip Intelligence

Production use
Aerial ocean and empty beach footage from El Sargento La Ventana, Mexico fits travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing quiet shoreline context.
Edit role
Use this short aerial view as an opener, transition, or breathing beat between closer shoreline details and wider travel or nature scenes.
Visual details
The frames show turquoise and deep blue ocean in the foreground, a pale empty beach curving along low coastal bluffs, distant hazy land on the horizon, clear daylight, and no visible people.
Shot mechanics
The composition reads as a high drone view over open water, with ocean filling most of the frame, the shoreline held along the right edge, and a level horizon across the upper third.

Tags

oceanbeachbeautifulcalmsereneskyviewemptylandnatureEL sargento LA ventana mexicofootagebuybusinessb-rollcinematicstunning

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
72 MB
Location
El Sargento La Ventana, Mexico
Year filmed
2020
Published
Jul 2020

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

High aerial view in El Sargento La Ventana, Mexico, with blue ocean filling the foreground, a curving empty beach on the right, hazy land on the horizon, and no visible people.
The opening frame establishes open water, pale sand, and low coastal terrain for a quiet Mexico shoreline sequence. (0:00)
Aerial frame from El Sargento La Ventana, Mexico, showing textured blue water in the foreground, the empty sand line along the right edge, low bluffs behind it, and no visible people.
This second frame keeps the coastline to the right while the water texture dominates the shot. (0:01)
Wide high view in El Sargento La Ventana, Mexico, with open blue water across most of the frame, a narrow empty beach and coastal bluffs near the upper right, and no visible people.
The frame gives editors a water-heavy composition with the shoreline present but secondary. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.