Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

EL SARGENTO LA VENTANA MEXICO-2020: Sky View Of Beautiful Ocean And Empty Beach

6s 4K UHD El Sargento La Ventana, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The calm waters stretch to the horizon under a clear sky, with no people in sight, creating a peaceful and contemplative atmosphere. This vintage-style footage offers a nostalgic glimpse of coastal tranquility, ideal for projects exploring nature, travel, or quiet moments by the sea.

Clip Intelligence

Production use
Aerial ocean and empty beach footage from El Sargento La Ventana, Mexico fits travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing quiet shoreline context.
Edit role
Use this short aerial view as an opener, transition, or breathing beat between closer shoreline details and wider travel or nature scenes.

Tags

oceanbeachbeautifulcalmsereneskyviewemptylandnatureEL sargento LA ventana mexico2020footagebuybusinessb-rollcinematicstunning

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
El Sargento La Ventana, Mexico
Year filmed
2020
Published
Jul 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

High aerial view in El Sargento La Ventana, Mexico, with blue ocean filling the foreground, a curving empty beach on the right, hazy land on the horizon, and no visible people.
The opening frame establishes open water, pale sand, and low coastal terrain for a quiet Mexico shoreline sequence. (0:00)
Aerial ocean view with the sandy shoreline and coastal bluffs held along the right side.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.