Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LOS CABOS MEXICO-2019: Airplane View Out of Window Over Lit City at Night

9s 4K UHD 29.97fps Los Cabos, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Shot from an airplane window at night, this 2019 home movie footage captures a glowing cityscape below, with twinkling lights stretching across the urban landscape. The view from above highlights the vibrant energy of a modern metropolis, offering a cinematic perspective of Los Cabos, Mexico. The warm glow of city lights contrasts with the dark sky, creating a visually striking and emotionally evocative scene. This authentic home movie offers a nostalgic yet contemporary glimpse of nighttime travel and urban beauty, perfect for documentaries, travel content, or emotional storytelling.

Clip Intelligence

Production use
Useful for travel edits, documentary transitions, agency mood reels, brand films, or social cuts needing an in-flight nighttime arrival view over Los Cabos, Mexico.
Edit role
The 9-second shot works as a short opener, transition, or reflective travel beat between airport, destination, and vacation sequence scenes.
Visual details
An airplane wing and engine fill the lower foreground while a lit city grid spreads below, with a dark blue sky and thin orange horizon band, and no visible people.

Tags

airplanecitylightsflyingskyviewwindowlitnighttimetransportationLOS cabos mexico2019b-rollpromoderncinematographycurrentbeautifulstunning

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
9s
Codec
H.264 MP4
File size
117 MB
Location
Los Cabos, Mexico
Year filmed
2019
Published
Oct 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Airplane window view over Los Cabos, Mexico, with the wing and engine in the foreground, a grid of city lights below, a faint orange horizon, and no visible people.
The opening frame shows the in-flight view over a lit city as the airplane wing crosses the foreground. (0:00)
Airplane window frame at night over Los Cabos, Mexico, with the engine low in frame, the wing angled right, scattered city lights below, and no visible people.
This frame keeps the aircraft structure prominent while the city lights stretch across the lower half of the shot. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.