Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Massively Green and Deep Warm Ocean (San Jose del Cabo, 2020)

6s 4K UHD 29.97fps Aerial San Jose del Cabo, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The camera glides over crystal-clear waters, revealing a massively green and deep ocean that glimmers in the warm sunlight. The natural beauty of the Pacific is on full display, with untouched waves lapping against the shore. This cinematic, amateur-style footage evokes a sense of wild serenity and tropical escape, perfect for travel, nature, or romantic storytelling.

Clip Intelligence

Production use
Useful for a travel edit, coastal documentary, agency mood reel, brand film, or social cut needing overhead 4K ocean texture from San Jose Del Cabo, Mexico.
Edit role
The short six-second runtime works as an opener, transition, visual texture, or calm insert between beach, resort, and wider Los Cabos sequence shots.
Visual details
Top-down frames show clear green-turquoise ocean water with small white sun glints, faint wave texture, darker underwater patches, and no visible people.
Shot mechanics
The composition is an aerial, downward-looking drone view with the frame filled entirely by ocean surface, no horizon, shoreline, buildings, or sky visible.

Tags

beachesoceancrystal clearwildmassivelygreendeepwarmnatureSAN jose DEL cabo mexicocinematicintrostunningbusinessartamatuer

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
74 MB
Location
San Jose Del Cabo, Mexico
Year filmed
2020
Published
Jul 2020

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead view of green-turquoise ocean water in San Jose Del Cabo, Mexico, with fine surface texture, scattered white reflections, and no visible people.
The opening frame gives editors a clean overhead ocean texture with the full frame filled by water. (0:00)
Aerial frame over clear green ocean in San Jose Del Cabo, Mexico, showing soft ripples, a few darker submerged areas, and no visible people.
This second shows the water plate continuing with subtle underwater variation and minimal visual clutter. (0:01)
Top-down San Jose Del Cabo ocean frame with turquoise water, small bright specks of reflected light, faint wave lines, and no visible people.
The frame supplies a simple mid-clip cutaway where reflected light breaks up the flat water color. (0:02)
Aerial view of green-blue ocean water in San Jose Del Cabo, Mexico, with smoother open areas, light ripple texture, and no visible people.
This moment emphasizes the broad uninterrupted water field for titles, transitions, or background use. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.