Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN JOSE DEL CABO MEXICO-2020: Massively Green and Deep Warm Ocean

6s 4K UHD San Jose Del Cabo, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The camera glides over crystal-clear waters, revealing a massively green and deep ocean that glimmers in the warm sunlight. The natural beauty of the Pacific is on full display, with untouched waves lapping against the shore. This cinematic, amateur-style footage evokes a sense of wild serenity and tropical escape, perfect for travel, nature, or romantic storytelling.

Clip Intelligence

Production use
Useful for a travel edit, coastal documentary, agency mood reel, brand film, or social cut needing overhead 4K ocean texture from San Jose Del Cabo, Mexico.
Edit role
The short six-second runtime works as an opener, transition, visual texture, or calm insert between beach, resort, and wider Los Cabos sequence shots.
Visual details
Top-down frames show clear green-turquoise ocean water with small white sun glints, faint wave texture, darker underwater patches, and no visible people.

Tags

beachesoceancrystal clearwildmassivelygreendeepwarmnatureSAN jose DEL cabo mexico2020cinematicintrostunningbusinessartamatuer

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
San Jose Del Cabo, Mexico
Year filmed
2020
Published
Jul 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead view of green-turquoise ocean water in San Jose Del Cabo, Mexico, with fine surface texture, scattered white reflections, and no visible people.
The opening frame gives editors a clean overhead ocean texture with the full frame filled by water. (0:00)
Aerial frame over clear green ocean in San Jose Del Cabo, Mexico, showing soft ripples, a few darker submerged areas, and no visible people.
This second shows the water plate continuing with subtle underwater variation and minimal visual clutter. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.