Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Shore Sea Beach Water Ocean Purism Beautiful (Shipwrecks Beach, 2020)

6s 4K UHD 29.97fps Beach Shipwrecks Beach, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Sun-drenched waves roll onto the sandy shore, with clear blue skies above and rugged rocks lining the coastline. The footage exudes a purist, cinematic calm, showcasing the natural harmony of sea, sand, and sky.

Clip Intelligence

Production use
Aerial beach footage for travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing Shipwrecks Beach in Baja California Sur with open sand, surf, and no visible crowds.
Edit role
Use this short six-second clip as a coastal opener, location transition, or breathing beat between closer beach details and wider East Cape shoreline coverage.
Visual details
The frames show turquoise water and white surf rolling onto a broad sandy beach, low dunes and dark scrub behind the shore, distant coastal buildings on a bluff, pink-blue sky, and no visible people.
Shot mechanics
The high aerial composition suggests DJI drone capture, with ocean filling the right foreground, surf and sand through the center, dunes and low buildings in the background, and a steady horizon across the sequence.

Tags

naturecleanskyrockstravelshoreseabeachwateroceanpurismbeautifulwavessurfingsandanimalswildlifeshipwrecks BEACH BCS mexicocinematic

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
74 MB
Location
Shipwrecks Beach, Baja California Sur, Mexico
Year filmed
2020
Published
Jul 2020

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view over Shipwrecks Beach in Baja California Sur, with turquoise water at right, pale surf along the sand, dark scrub behind the dunes, distant buildings, and no visible people.
The opening frame establishes the broad beach curve, surf line, dunes, and distant bluff structures. (0:00)
Wide aerial frame of Shipwrecks Beach, Baja California Sur, showing white waves brushing the shoreline, open tan sand, scrub-covered dunes, small distant buildings on the bluff, and no visible people.
This moment keeps the surf line centered while showing the undeveloped sand and low coastal vegetation. (0:01)
Aerial shoreline view at Shipwrecks Beach in Baja California Sur, with teal ocean in the foreground, white foam reaching the beach, dune ridges to the left, distant coastal structures, and no visible people.
The frame emphasizes the color contrast between teal water, white foam, and warm sand. (0:02)
Shipwrecks Beach aerial frame with darker shoreline rocks near the lower center, white surf curling around them, broad sand, scrubby dunes, distant buildings, and no visible people.
This frame introduces the dark rocks in the surf, useful as a visual anchor within the coastline. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.