Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SHIPWRECKS BEACH BCS MEXICO-2020: Bird's Eye Overhead View Of Beautiful Clear Waters

6s 4K UHD Shipwrecks Beach, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The clear, turquoise waters stretch across the frame, revealing a serene and untouched coastal landscape. The vibrant green hues of the ocean contrast with the sandy shore, creating a stunning natural scene. This vintage-style footage offers a nostalgic glimpse of a remote beach, perfect for documentaries, travel content, or nature-themed projects. The cinematic quality and tranquil mood evoke a sense of peace and wonder.

Clip Intelligence

Production use
Useful for travel edits, coastal documentary sequences, agency mood reels, brand films, or social cuts needing overhead 4K water texture from Shipwrecks Beach in Baja California Sur, Mexico.
Edit role
This short overhead water shot works as a quiet opener, cutaway, transition, or texture beat between beach, shoreline, and surf scenes in the same sequence.
Visual details
The frames show clear turquoise-green water over pale sand with dark submerged rock or reef patches, soft surface ripples, no horizon, no boats, and no visible people.

Tags

seawateroceannaturebeautifulbird'seyeoverheadviewcleargreenemptyshipwrecks BEACH BCS mexico2020currentcinematiccuteprettynew

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Shipwrecks Beach, Baja California Sur, Mexico
Year filmed
2020
Published
Jul 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead view of turquoise water at Shipwrecks Beach, Baja California Sur, with pale sand below, dark underwater rock patches, and no visible people.
The opening frame sets up the clip as a top-down water texture with shallow sand and submerged dark forms. (0:00)
Clear green-blue water fills the frame at Shipwrecks Beach, Baja California Sur, with a broad dark patch near the lower left and no visible people.
This second moment keeps the frame fully on water, useful as an uninterrupted aerial insert. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.