Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SHIPWRECKS BEACH BCS MEXICO-2020: Bright Yellow Fishes Elegantly Splash Around

6s 4K UHD Shipwrecks Beach, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Ideal for nature documentaries, travel content, or nostalgic storytelling.

Clip Intelligence

Production use
Travel editors, wildlife documentary producers, agency mood reels, and social cuts can use this 4K view of yellow fish over turquoise water from Shipwrecks Beach, Baja California Sur.
Edit role
Use this short clip as a marine-life insert, a quiet transition between shoreline shots, or a visual texture beat inside a beach or coastal travel sequence.
Visual details
Small bright yellow fish appear against clear green-turquoise water with darker submerged rock shapes below, shifting surface ripples, and no visible people.

Tags

fishaquaticsea-lifeoceanriverseagoldfishfishesyellowbrightelegantlysplashgreenanimalswildlifeshipwrecks BEACH BCS mexico2020intro

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Shipwrecks Beach, Baja California Sur, Mexico
Year filmed
2020
Published
Jul 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead view of turquoise water at Shipwrecks Beach with a small yellow fish near darker submerged rock shapes and no visible people.
Opening frame shows the clip's fish detail against clear green-blue coastal water. (0:00)
Clear green-blue water at Shipwrecks Beach shows a yellow fish crossing above shadowed rocks beneath the rippled surface, with no visible people.
This moment gives editors a clean marine-life insert with the fish separated by color from the water. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.