Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Bright Yellow Fishes Elegantly Splash Around (Shipwrecks Beach, 2020)

6s 4K UHD 29.97fps Wildlife Shipwrecks Beach, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Ideal for nature documentaries, travel content, or nostalgic storytelling.

Clip Intelligence

Production use
Travel editors, wildlife documentary producers, agency mood reels, and social cuts can use this 4K view of yellow fish over turquoise water from Shipwrecks Beach, Baja California Sur.
Edit role
Use this short clip as a marine-life insert, a quiet transition between shoreline shots, or a visual texture beat inside a beach or coastal travel sequence.
Visual details
Small bright yellow fish appear against clear green-turquoise water with darker submerged rock shapes below, shifting surface ripples, and no visible people.
Shot mechanics
The frames read as an overhead aerial composition, likely from a DJI drone per the camera hint, with the water surface filling the frame and no horizon or shoreline visible.

Tags

fishaquaticsea-lifeoceanriverseagoldfishfishesyellowbrightelegantlysplashgreenanimalswildlifeshipwrecks BEACH BCS mexicointro

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
76 MB
Location
Shipwrecks Beach, Baja California Sur, Mexico
Year filmed
2020
Published
Jul 2020

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead view of turquoise water at Shipwrecks Beach with a small yellow fish near darker submerged rock shapes and no visible people.
Opening frame shows the clip's fish detail against clear green-blue coastal water. (0:00)
Clear green-blue water at Shipwrecks Beach shows a yellow fish crossing above shadowed rocks beneath the rippled surface, with no visible people.
This moment gives editors a clean marine-life insert with the fish separated by color from the water. (0:01)
A small yellow fish appears in bright turquoise water at Shipwrecks Beach, with soft underwater texture and no visible shoreline or people.
The frame emphasizes the bright fish color against an open field of turquoise water. (0:02)
Rippling turquoise water fills the Shipwrecks Beach frame, with darker submerged forms below and only a faint yellow fish detail visible, no visible people.
This frame works as water texture with only a small flash of fish color in the scene. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.