Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Fish Swimming In The Ocean (Shipwrecks Beach, 2020)

6s 4K UHD 29.97fps Wildlife Shipwrecks Beach, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The natural underwater scene features vibrant marine life gliding through the ocean, offering a serene and immersive glimpse into the region's coastal ecosystem. Ideal for documentaries, travel features, and environmental storytelling.

Clip Intelligence

Production use
Travel editors, documentary producers, agency mood reels, brand films, and social cuts can use this 4K ocean wildlife clip for Baja California Sur marine habitat context.
Edit role
The short runtime works best as a water-texture cutaway, quiet transition, or insert between wider beach and shoreline shots in a coastal sequence.
Visual details
Top-down turquoise ocean fills the frame, with submerged rock or reef shapes under the surface, small yellow fish visible in several moments, rippled light, and no visible people.
Shot mechanics
The composition reads as a high overhead aerial view with no horizon, keeping water, underwater rock forms, and tiny fish as the full-frame foreground and midground.

Tags

fishoceanwaterbeautifulseatropicalswimminganimalswildlifeshipwrecks BEACH BCS mexicoemotionfootageb-rollcinematographyintroductionkind

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
77 MB
Location
Shipwrecks Beach, Baja California Sur, Mexico
Year filmed
2020
Published
Jul 2020

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

At Shipwrecks Beach in Baja California Sur, turquoise water covers submerged rock shapes while a small yellow fish appears near the left side, with no visible people.
The opening frame introduces the overhead ocean view and small fish detail. (0:00)
At Shipwrecks Beach in Baja California Sur, a small yellow fish sits near the upper part of the overhead frame above faint underwater rocks, with no visible people.
This frame shows the fish isolated against the broad turquoise water surface. (0:01)
At Shipwrecks Beach in Baja California Sur, green-blue ocean water reveals darker underwater forms while a small yellow fish crosses the upper portion, with no visible people.
The second-second still keeps the marine-life detail small within a wide overhead water texture. (0:02)
At Shipwrecks Beach in Baja California Sur, rocky patches show through the turquoise water and a tiny yellow fish appears near left center, with no visible people.
This moment gives editors a clean overhead insert of fish movement above reef-like texture. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.