Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SHIPWRECKS BEACH BCS MEXICO-2020: Fish Swimming In The Ocean

6s 4K UHD Shipwrecks Beach, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The natural underwater scene features vibrant marine life gliding through the ocean, offering a serene and immersive glimpse into the region's coastal ecosystem. Ideal for documentaries, travel features, and environmental storytelling.

Clip Intelligence

Production use
Travel editors, documentary producers, agency mood reels, brand films, and social cuts can use this 4K ocean wildlife clip for Baja California Sur marine habitat context.
Edit role
The short runtime works best as a water-texture cutaway, quiet transition, or insert between wider beach and shoreline shots in a coastal sequence.
Visual details
Top-down turquoise ocean fills the frame, with submerged rock or reef shapes under the surface, small yellow fish visible in several moments, rippled light, and no visible people.

Tags

fishoceanwaterbeautifulseatropicalswimminganimalswildlifeshipwrecks BEACH BCS mexico2020emotionfootageb-rollcinematographyintroductionkind

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Shipwrecks Beach, Baja California Sur, Mexico
Year filmed
2020
Published
Jul 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

At Shipwrecks Beach in Baja California Sur, turquoise water covers submerged rock shapes while a small yellow fish appears near the left side, with no visible people.
The opening frame introduces the overhead ocean view and small fish detail. (0:00)
At Shipwrecks Beach in Baja California Sur, a small yellow fish sits near the upper part of the overhead frame above faint underwater rocks, with no visible people.
This frame shows the fish isolated against the broad turquoise water surface. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.