Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN JOSE DEL CABO BCS MEXICO-2020: Bright Green Palm Trees Being Swayed By Wind

7s 4K UHD San Jose Del Cabo, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The vibrant tropical scene features crashing waves, colorful buildings, and lush foliage under a clear blue sky.

Clip Intelligence

Production use
Use this San Jose del Cabo clip for travel edits, documentary location context, agency mood reels, brand films, or social cuts needing coastal homes, palms, and turquoise surf in Baja California Sur.
Edit role
The seven-second view works as a cutaway or transition beat between beach activity, vacation rental exteriors, and shoreline wave shots in a San Jose del Cabo sequence.

Tags

orangecitybeach towntreeswaterbrightgreenpalmswayedwindwavescrashcolorfulbuildingslandmarksSAN jose DEL cabo BCS mexico C2020artcinematicdigital

Shot slate

Resolution
4K UHD
Duration
7s
Codec
H.264 MP4
Location
San Jose Del Cabo, Baja California Sur, Mexico
Year filmed
2020
Published
Oct 2020

Still Frames From This Clip

One frame exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening view in San Jose del Cabo shows green palms, orange and cream buildings, red tile roofs, and turquoise ocean in the background with no visible people.
The first frame sets the coastal neighborhood composition with palms and ocean beyond the roofs. (0:00)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.