Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Bright Green Palm Trees Being Swayed By Wind (San Jose del Cabo, 2020)

7s 4K UHD 29.97fps Beach San Jose del Cabo, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The vibrant tropical scene features crashing waves, colorful buildings, and lush foliage under a clear blue sky.

Clip Intelligence

Production use
Use this San Jose del Cabo clip for travel edits, documentary location context, agency mood reels, brand films, or social cuts needing coastal homes, palms, and turquoise surf in Baja California Sur.
Edit role
The seven-second view works as a cutaway or transition beat between beach activity, vacation rental exteriors, and shoreline wave shots in a San Jose del Cabo sequence.
Visual details
Frames show red tile roofs, orange and cream building walls, dense green palms and trees, turquoise ocean behind them, bright daylight color, and no visible people.

Tags

orangecitybeach towntreeswaterbrightgreenpalmswayedwindwavescrashcolorfulbuildingslandmarksSAN jose DEL cabo BCS mexico Cartcinematicdigital

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
7s
Codec
H.264 MP4
File size
85 MB
Location
San Jose Del Cabo, Baja California Sur, Mexico
Year filmed
2020
Published
Oct 2020

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening view in San Jose del Cabo shows green palms, orange and cream buildings, red tile roofs, and turquoise ocean in the background with no visible people.
The first frame sets the coastal neighborhood composition with palms and ocean beyond the roofs. (0:00)
At one second, San Jose del Cabo rooftops and palms remain centered while pale surf lines appear behind the trees, with no visible people.
This moment gives editors a clear mix of vacation-style architecture, palms, and moving surf texture. (0:01)
At two seconds, the frame holds on San Jose del Cabo buildings partly hidden by dense palms, with turquoise ocean filling the upper background and no visible people.
The frame emphasizes layered foliage in front of the coastal buildings and water. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.