Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

CABO SAN LUCAS MEXICO-2020: Panning Over Competition Swimming Pool Lanes With

7s 4K UHD Cabo San Lucas, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Panning shot over competition swimming pool lanes in Cabo San Lucas, Mexico, 2020. The footage captures the vibrant blue water and marked lanes of a professional pool, likely used for training or local aquatic events. The smooth camera movement highlights the symmetry and structure of the pool, evoking a sense of calm and focus. Ideal for documentaries, travel features, or background footage on aquatic activities.

Clip Intelligence

Production use
Travel edits, documentary segments, agency mood reels, brand films, and social cuts can use this Cabo San Lucas pool-lane clip for a clean aquatic sports or resort-training visual.
Edit role
The 7-second shot works as a cutaway, transition, or quiet insert between broader Cabo San Lucas water scenes and human activity around recreation or swim training.
Visual details
Bright blue pool water fills the frame with black lane markings, white floating lane ropes, triangular backstroke flags in later frames, sharp shadows, and no visible people.

Tags

poollanescompetecompetitionlessonsolympicsfastswimdeeppanningswimmingflagshangingsportsrecreationcabo SAN lucas mexico C2020kindabstractintroduction

Shot slate

Resolution
4K UHD
Duration
7s
Codec
H.264 MP4
Location
Cabo San Lucas, Mexico
Year filmed
2020
Published
Oct 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Blue competition pool water in Cabo San Lucas with a white lane rope crossing the left side, black lane markings below the surface, and no visible people.
The opening frame shows the pool surface as a graphic aquatic detail for a Cabo San Lucas sequence. (0:00)
Turquoise pool water in Cabo San Lucas with a floating lane rope near the center-left, black floor lines, triangular distance markers, and no visible people.
This frame keeps the lane rope and pool markings central for a clean swimming-training insert. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.