Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Panning Over Competition Swimming Pool Lanes With (Cabo San Lucas, 2020)

7s 4K UHD 29.97fps Architecture Cabo San Lucas, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Panning shot over competition swimming pool lanes in Cabo San Lucas, Mexico, 2020. The footage captures the vibrant blue water and marked lanes of a professional pool, likely used for training or local aquatic events. The smooth camera movement highlights the symmetry and structure of the pool, evoking a sense of calm and focus. Ideal for documentaries, travel features, or background footage on aquatic activities.

Clip Intelligence

Production use
Travel edits, documentary segments, agency mood reels, brand films, and social cuts can use this Cabo San Lucas pool-lane clip for a clean aquatic sports or resort-training visual.
Edit role
The 7-second shot works as a cutaway, transition, or quiet insert between broader Cabo San Lucas water scenes and human activity around recreation or swim training.
Visual details
Bright blue pool water fills the frame with black lane markings, white floating lane ropes, triangular backstroke flags in later frames, sharp shadows, and no visible people.
Shot mechanics
A ground-camera panning shot looks down across the competition pool surface, keeping lane ropes and black floor markings as the main graphic lines through the frame.

Tags

poollanescompetecompetitionlessonsolympicsfastswimdeeppanningswimmingflagshangingsportsrecreationcabo SAN lucas mexico Ckindabstractintroduction

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
7s
Codec
H.264 MP4
File size
86 MB
Location
Cabo San Lucas, Mexico
Year filmed
2020
Published
Oct 2020

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Blue competition pool water in Cabo San Lucas with a white lane rope crossing the left side, black lane markings below the surface, and no visible people.
The opening frame shows the pool surface as a graphic aquatic detail for a Cabo San Lucas sequence. (0:00)
Turquoise pool water in Cabo San Lucas with a floating lane rope near the center-left, black floor lines, triangular distance markers, and no visible people.
This frame keeps the lane rope and pool markings central for a clean swimming-training insert. (0:01)
Sunlit Cabo San Lucas pool lane with a white floating rope, dark T-shaped floor markings, small triangular markers, and no visible people.
The frame emphasizes the formal competition-pool layout through the T markings and lane rope. (0:02)
Cabo San Lucas competition pool surface with a lane rope along the left edge, dark black lane markings across blue water, bright light reflection, and no visible people.
This moment provides a simple cutaway of lane geometry and reflected sun on the water. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.