Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

CABO SAN LUCAS MEXICO-2020: Children Sitting On The Edge Of A Pool Splashing And Playing

7s 4K UHD Cabo San Lucas, Mexico 2020
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

Children sit at the edge of a pool in Cabo San Lucas, Mexico, splashing water and playing in the sun. Ideal for projects exploring childhood, summer fun, family life, or tropical vacations.

Clip Intelligence

Production use
a people and travel b-roll clip for a family vacation edit, documentary segment, agency mood reel, brand film, or social cut needing children in a pool in Cabo San Lucas, Mexico.
Edit role
Use this seven-second shot as a cutaway, insert, or light activity beat between wider resort, beach, or ocean footage in a family travel sequence.

Tags

poolchildrenswimmingplaykidssittingedgesplashingplayingpeoplecabo SAN lucas mexico C2020romanceamateurb-rollmodernprettycutebeautiful

Shot slate

Resolution
4K UHD
Duration
7s
Codec
H.264 MP4
Location
Cabo San Lucas, Mexico
Year filmed
2020
Published
Oct 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Children wearing swim caps and goggles sit along a pool edge in Cabo San Lucas, Mexico, while an adult instructor faces them from the foreground water.
This opening frame shows the supervised pool setup with children lined along the edge. (0:00)
A child swims near the pool edge while other children watch.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.