Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Children Sitting On The Edge Of A Pool Splashing And Playing (Cabo San Lucas, 2020)

7s 4K UHD 29.97fps People Cabo San Lucas, Mexico 2020
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

Children sit at the edge of a pool in Cabo San Lucas, Mexico, splashing water and playing in the sun. Ideal for projects exploring childhood, summer fun, family life, or tropical vacations.

Clip Intelligence

Production use
a people and travel b-roll clip for a family vacation edit, documentary segment, agency mood reel, brand film, or social cut needing children in a pool in Cabo San Lucas, Mexico.
Edit role
Use this seven-second shot as a cutaway, insert, or light activity beat between wider resort, beach, or ocean footage in a family travel sequence.
Visual details
Children in swim caps and goggles sit along a pool edge while one child swims near the foreground and an adult instructor is in the water, with turquoise pool color, wet concrete, and sunlit swimwear visible.
Shot mechanics
The camera looks across the pool from a slightly elevated ground position, holding the children along the far edge in the upper frame and the instructor and swimmer in the foreground water.

Tags

poolchildrenswimmingplaykidssittingedgesplashingplayingpeoplecabo SAN lucas mexico Cromanceamateurb-rollmodernprettycutebeautiful

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
7s
Codec
H.264 MP4
File size
88 MB
Location
Cabo San Lucas, Mexico
Year filmed
2020
Published
Oct 2020

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Children wearing swim caps and goggles sit along a pool edge in Cabo San Lucas, Mexico, while an adult instructor faces them from the foreground water.
This opening frame shows the supervised pool setup with children lined along the edge. (0:00)
A child in a pink swim cap moves through the foreground pool water in Cabo San Lucas, Mexico, as other children sit and watch from the edge.
This frame adds action as one child swims in front of the seated group. (0:01)
An adult instructor in the foreground water gestures toward children in swim caps seated on the pool edge in Cabo San Lucas, Mexico.
This moment shows the instructor engaging the group during the pool activity. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.