Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Wetland Patches Drifting in Coastal Waters by Sandy Beach (San Jose del Cabo Estuary, 2021)

6s 4K UHD 29.97fps Beach San Jose del Cabo Estuary, Baja California Sur, Mexico 2021
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The sequence shows green vegetation patches floating in shallow coastal waters near a sandy beach. The vegetation drifts slowly as the camera moves, revealing the ocean and distant hills under a clear blue sky. The scene remains calm with no visible human activity.

Clip Intelligence

Production use
Fits travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing aerial wetland water, sandy beach, turquoise ocean, and Baja California Sur landscape context.
Edit role
Works as a short opener, transition, or cutaway between river, lagoon, and beach shots, giving editors a calm six-second aerial beat over shallow water before moving to the shoreline or ocean.
Visual details
Green wetland patches sit in shallow blue-green water in the foreground, a bright sandy beach and turquoise ocean run across the midground, distant hills line the horizon, and no people are visible.
Shot mechanics
Aerial drone framing looks across the estuary water toward the beach and ocean, with foreground vegetation patches, a low horizon, and steady wide composition supported by the DJI drone camera hint.

Tags

coastalwetlandvegetationwatersandy beachoceanblue skygreendriftingaerialcalmlandscapeshorewaterwaynaturalclearhorizonhills

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
75 MB
Location
San Jose Del Cabo Estuary, Baja California Sur, Mexico
Year filmed
2021
Published
Apr 2021

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Wide aerial view over San Jose Del Cabo Estuary with green wetland patches in shallow water, a sandy beach beyond them, turquoise ocean, distant hills, and no visible people.
The opening frame sets the estuary vegetation against the beach and open ocean. (0:00)
Aerial frame from San Jose Del Cabo Estuary showing scattered green vegetation mats across shallow water, with a bright sandbar-like beach, blue ocean, low hills, and no visible people.
This second frame keeps the vegetation mats prominent while the beach and horizon stay clear. (0:01)
San Jose Del Cabo Estuary appears from above with a broad foreground of blue-green water, clustered wetland plants near center, a pale sandy shoreline, ocean water, distant hills, and no visible people.
The frame gives editors a balanced view of wetland water, shoreline, ocean, and hills. (0:02)
A wide aerial moment over San Jose Del Cabo Estuary places small green vegetation islands across shallow water, with the sandy beach and darker blue ocean stretching behind, and no visible people.
This frame emphasizes the open water area before the shoreline and ocean band. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.