Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN JOSE DEL CABO ESTUARY BCS MEXICO-2021: Wetland Patches Drifting in Coastal Waters by Sandy Beach

6s 4K UHD San Jose Del Cabo Estuary, Baja California Sur, Mexico 2021
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The sequence shows green vegetation patches floating in shallow coastal waters near a sandy beach. The vegetation drifts slowly as the camera moves, revealing the ocean and distant hills under a clear blue sky. The scene remains calm with no visible human activity.

Clip Intelligence

Production use
Fits travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing aerial wetland water, sandy beach, turquoise ocean, and Baja California Sur landscape context.
Edit role
Works as a short opener, transition, or cutaway between river, lagoon, and beach shots, giving editors a calm six-second aerial beat over shallow water before moving to the shoreline or ocean.
Visual details
Green wetland patches sit in shallow blue-green water in the foreground, a bright sandy beach and turquoise ocean run across the midground, distant hills line the horizon, and no people are visible.

Tags

SAN JOSE DEL CABO ESTUARY BCS MEXICO2021coastalwetlandvegetationwatersandy beachoceanblue skygreendriftingaerialcalmlandscapeshorewaterwaynaturalclearhorizonhills

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
San Jose Del Cabo Estuary, Baja California Sur, Mexico
Year filmed
2021
Published
Apr 2021

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Wide aerial view over San Jose Del Cabo Estuary with green wetland patches in shallow water, a sandy beach beyond them, turquoise ocean, distant hills, and no visible people.
The opening frame sets the estuary vegetation against the beach and open ocean. (0:00)
Aerial frame from San Jose Del Cabo Estuary showing scattered green vegetation mats across shallow water, with a bright sandbar-like beach, blue ocean, low hills, and no visible people.
This second frame keeps the vegetation mats prominent while the beach and horizon stay clear. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.