Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN JOSE DEL CABO BCS MEXICO-2021: Apartment Complex and Road Traffic Aerial View

6s 4K UHD San Jose Del Cabo, Baja California Sur, Mexico 2021
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

An aerial view captures a residential neighborhood with apartment buildings. Cars move along the road, while the buildings and green spaces remain static. The sequence shows the progression of traffic over time.

Clip Intelligence

Production use
Aerial neighborhood footage for travel edits, documentary context, agency mood reels, brand films, or social cuts needing San Jose Del Cabo residential streets, apartment buildings, parked cars, and green space.

Tags

SAN JOSE DEL CABO BCS MEXICO2021apartmentcomplexroadtrafficcarsmovingaerialviewgreengrasspalmtreesparkinglotstreeturbanneighborhoodvehicles

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
San Jose Del Cabo, Baja California Sur, Mexico
Year filmed
2021
Published
Apr 2021

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.