Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Apartment Complex and Road Traffic Aerial View (San Jose del Cabo, 2021)

6s 4K UHD 29.97fps Urban San Jose del Cabo, Baja California Sur, Mexico 2021
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

An aerial view captures a residential neighborhood with apartment buildings. Cars move along the road, while the buildings and green spaces remain static. The sequence shows the progression of traffic over time.

Clip Intelligence

Production use
Aerial neighborhood footage for travel edits, documentary context, agency mood reels, brand films, or social cuts needing San Jose Del Cabo residential streets, apartment buildings, parked cars, and green space.
Edit role
Use this short aerial clip as a cutaway or transition between broader San Jose Del Cabo city views and closer street-level traffic or residential scenes.
Visual details
The frames show red-roof apartment blocks, a curved road lined with parked cars, small moving vehicles, palm trees, tan open ground, bright green lawns, and strong daylight with no visible people.
Shot mechanics
High-angle drone composition looks down over the road in the foreground and midground, with apartment buildings, parking areas, palms, and landscaped grass filling the upper frame.

Tags

apartmentcomplexroadtrafficcarsmovingaerialviewgreengrasspalmtreesparkinglotstreeturbanneighborhoodvehicles

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
76 MB
Location
San Jose Del Cabo, Baja California Sur, Mexico
Year filmed
2021
Published
Apr 2021

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial frame over San Jose Del Cabo apartments with a curved road, rows of parked cars, green lawn patches, palm trees, tan open ground, and no visible people.
The first frame establishes the residential road layout and apartment complex from above. (0:00)
One second into the San Jose Del Cabo aerial, the apartment row and curved street remain centered, with parked cars, a blue court area, palms, green lawns, tan ground, and no visible people.
This moment keeps the apartments and road traffic in a balanced overhead composition. (0:01)
At 0:02, the San Jose Del Cabo frame shows the apartment complex, a nearby road intersection, parked cars along the curb, palm-lined landscaping, green lawn areas, and no visible people.
The frame adds the nearby intersection and curbside parking as useful traffic context. (0:02)
Overhead frame of red-roof buildings, a curved road with cars, palms, green grass, and tan open ground.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.