Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Hilltop View of City and Mountain Range (San Jose del Cabo, 2020)

6s 4K UHD 29.97fps Landscape San Jose del Cabo, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The video captures a slow camera pan across a cityscape with a mountain range in the background. A hill in the foreground has scattered buildings and greenery, while the city extends toward the mountains. The sky remains clear and blue throughout the sequence.

Clip Intelligence

Production use
Useful for travel edits, documentary context, agency mood reels, brand films, or social cuts that need a daylight aerial view of San Jose del Cabo with city growth, hills, roads, and mountains in one frame.
Edit role
The short 4K view works as an opener, transition, or geography cutaway between closer street, resort, pool, or neighborhood scenes in a San Jose del Cabo sequence.
Visual details
Frames show a broad hillside cityscape with roads, scattered homes, larger buildings, green-brown hills, hazy mountain ridges, clear blue sky, strong daytime light, and no visible people.
Shot mechanics
The clip is supported as DJI drone aerial capture, with a high vantage composition layering foreground hillside roads, midground city blocks, and a distant mountain horizon under a wide sky.

Tags

citymountainshillbuildingslandscapeaerialurbangreenblue skycleardaytimecityscapevantage pointopen spaceroadhillsclear skyroads

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
74 MB
Location
San Jose Del Cabo, Mexico
Year filmed
2020
Published
Nov 2020

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial view over San Jose del Cabo with hillside roads and buildings in the foreground, a dense city grid beyond, distant mountains, clear blue sky, and no visible people.
The first frame sets the full city-and-mountain geography from a high daylight vantage point. (0:00)
San Jose del Cabo appears from above with low hills in front, clustered buildings and roads across the middle ground, hazy mountain ridges in back, and no visible people.
This moment keeps the city blocks centered while the surrounding hills and mountains frame the location. (0:01)
A high aerial frame shows San Jose del Cabo spread below, with a curving road and hillside homes in the foreground, larger urban blocks in the distance, mountains on the horizon, and no visible people.
The frame emphasizes the relationship between the foreground hillside roads and the wider city beyond. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.