Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN JOSE DEL CABO MEXICO-2020: Hilltop View of City and Mountain Range

6s 4K UHD San Jose Del Cabo, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The video captures a slow camera pan across a cityscape with a mountain range in the background. A hill in the foreground has scattered buildings and greenery, while the city extends toward the mountains. The sky remains clear and blue throughout the sequence.

Clip Intelligence

Production use
Useful for travel edits, documentary context, agency mood reels, brand films, or social cuts that need a daylight aerial view of San Jose del Cabo with city growth, hills, roads, and mountains in one frame.
Edit role
The short 4K view works as an opener, transition, or geography cutaway between closer street, resort, pool, or neighborhood scenes in a San Jose del Cabo sequence.

Tags

SAN JOSE DEL CABO MEXICO2020citymountainshillbuildingslandscapeaerialurbangreenblue skycleardaytimecityscapevantage pointopen spaceroadhillsclear skyroads

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
San Jose Del Cabo, Mexico
Year filmed
2020
Published
Nov 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial view over San Jose del Cabo with hillside roads and buildings in the foreground, a dense city grid beyond, distant mountains, clear blue sky, and no visible people.
The first frame sets the full city-and-mountain geography from a high daylight vantage point. (0:00)
Aerial view of hillside buildings, city blocks, distant mountains, and clear sky.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.