Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

CABO PULMO BCS MEXICO-2020: Coastal Mountain Range with Moving Vehicle

6s 4K UHD Cabo Pulmo, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The video shows a mountainous coastal area with a sandy beach and ocean. A vehicle moves along a road on the mountain slope, visible as a white streak. The landscape consists of arid, brown mountains under a clear blue sky.

Clip Intelligence

Production use
Aerial coastal desert footage from Cabo Pulmo fits travel edits, environmental documentaries, agency mood reels, brand films, and social cuts needing mountains, beach, ocean, and open Baja California Sur terrain.
Edit role
Use this short 4K clip as an opener, geographic cutaway, transition beat, or sequence bridge between desert-road movement and the wider coastline.
Visual details
Brown arid mountain ridges fill the foreground and midground, a pale beach and turquoise ocean sit beyond them under a clear blue sky, with a tiny white vehicle trace on the slope and no visible people.

Tags

CABO PULMO BCS MEXICO2020mountaincoastoceanbeachroadvehiclemovingaeriallandscapearidbrownblueclear skydryterrainpathtrafficvehicle movement

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Cabo Pulmo, Baja California Sur, Mexico
Year filmed
2020
Published
Dec 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial frame over Cabo Pulmo with brown desert hills in the foreground, a pale beach along the coast, blue ocean beyond, clear sky, and no visible people.
This opening moment sets the mountain-to-ocean geography of the Cabo Pulmo clip. (0:00)
Second frame shows Cabo Pulmo's dry mountain ridges lower in frame, the coastline running across the middle distance, blue ocean at the horizon, and no visible people.
The frame holds a wide drone perspective useful for showing the roaded desert hills beside the sea. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.