Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Coastal Mountain Range with Moving Vehicle (Cabo Pulmo, 2020)

6s 4K UHD 29.97fps Aerial Cabo Pulmo, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The video shows a mountainous coastal area with a sandy beach and ocean. A vehicle moves along a road on the mountain slope, visible as a white streak. The landscape consists of arid, brown mountains under a clear blue sky.

Clip Intelligence

Production use
Aerial coastal desert footage from Cabo Pulmo fits travel edits, environmental documentaries, agency mood reels, brand films, and social cuts needing mountains, beach, ocean, and open Baja California Sur terrain.
Edit role
Use this short 4K clip as an opener, geographic cutaway, transition beat, or sequence bridge between desert-road movement and the wider coastline.
Visual details
Brown arid mountain ridges fill the foreground and midground, a pale beach and turquoise ocean sit beyond them under a clear blue sky, with a tiny white vehicle trace on the slope and no visible people.
Shot mechanics
The frames support an aerial drone vantage with a high, wide composition, layered hills in the lower frame, coastline across the middle distance, and a level ocean horizon near the upper third.

Tags

mountaincoastoceanbeachroadvehiclemovingaeriallandscapearidbrownblueclear skydryterrainpathtrafficvehicle movement

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
75 MB
Location
Cabo Pulmo, Baja California Sur, Mexico
Year filmed
2020
Published
Dec 2020

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial frame over Cabo Pulmo with brown desert hills in the foreground, a pale beach along the coast, blue ocean beyond, clear sky, and no visible people.
This opening moment sets the mountain-to-ocean geography of the Cabo Pulmo clip. (0:00)
Second frame shows Cabo Pulmo's dry mountain ridges lower in frame, the coastline running across the middle distance, blue ocean at the horizon, and no visible people.
The frame holds a wide drone perspective useful for showing the roaded desert hills beside the sea. (0:01)
At 0:02, the aerial view keeps the brown Cabo Pulmo hills dominant while the pale shoreline and turquoise-blue ocean stretch across the background, with no visible people.
This frame emphasizes the contrast between dry mountain terrain and open water. (0:02)
Mid-clip frame over Cabo Pulmo shows layered arid hills, a thin coastal road or track, pale surf line, deep blue ocean, clear sky, and no visible people.
The mid-clip view gives editors a clean geographic cutaway with mountain ridges leading to the coast. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.