Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Car Moving Along Residential Street with Median (San Jose del Cabo, 2021)

7s 4K UHD 29.97fps Road San Jose del Cabo, Baja California Sur, Mexico 2021
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A silver car moves along a two-lane residential street with a grassy median. A white truck is parked on the right side of the street. The shadow of a streetlight shifts as the car travels, indicating movement.

Clip Intelligence

Production use
Useful for travel edits, documentary context, agency mood reels, brand films, or social cuts needing an overhead view of a quiet residential street in San Jose del Cabo, Baja California Sur.
Edit role
The 7 second clip works as a short cutaway, transition, or neighborhood texture beat between wider city views and closer street-level details.
Visual details
Overhead frames show a silver car moving along a paved two-lane residential street with a grassy median, sidewalks, trees, streetlight shadows, a parked white truck, homes along the curb, and no visible people.
Shot mechanics
The composition is a top-down DJI drone-style aerial view with the road and median running horizontally through frame, while the silver car changes position across the sequence.

Tags

streetmediancarmovingresidentialhousesgrassshadowstreetlightaerialoverheadtwo-lanepavementsidewalktreeswhitetrucksilver

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
7s
Codec
H.264 MP4
File size
86 MB
Location
San Jose Del Cabo, Baja California Sur, Mexico
Year filmed
2021
Published
Aug 2021

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Top-down aerial frame in San Jose del Cabo shows a silver car near the left side of a quiet residential street, a grassy median below it, a parked white truck near the upper right curb, and no visible people.
The opening frame sets the overhead residential street layout with the moving silver car entering the shot area. (0:00)
At 0:01, the San Jose del Cabo aerial view shows the silver car farther along the upper roadway, with the green median, curbside sidewalks, a parked white truck, trees, and no visible people.
This frame shows the car progressing along the residential road while the median keeps the composition structured. (0:01)
At 0:02, the top-down San Jose del Cabo frame places the silver car along the upper lane near curbside homes, with the parked white truck ahead, landscaped median below, and no visible people.
The frame gives a clean insert of the moving car in relation to the parked truck and residential frontage. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.