Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

CERRITOS BEACH BCS MEXICO-2021: Sandy Beach and Green Fields Along Coastline

6s 4K UHD Cerritos Beach, Baja California Sur, Mexico 2021
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

An aerial view of a sandy beach bordering the ocean, with green fields and scattered buildings extending inland. The camera moves slowly, revealing more of the coastal landscape and distant hills. The clear blue sky and calm ocean waters are visible throughout the sequence.

Clip Intelligence

Production use
Useful for travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing a 2021 aerial view of Cerritos Beach in Baja California Sur.
Edit role
Works as a short opener, geographic cutaway, or transition beat that places the viewer above the beach before cutting into dunes, roads, buildings, or rural inland coverage.
Visual details
The frames show blue ocean on the left, a pale sandy surf line, green fields and scrub inland, dirt roads, scattered low buildings, distant hills, clear sky, and no visible people.

Tags

CERRITOS BEACH BCS MEXICO2021oceancoastsandygreenfieldslandscapeaerialviewcoastalhillsbuildingsroadsblueclearskynaturalscenerycoastline

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Cerritos Beach, Baja California Sur, Mexico
Year filmed
2021
Published
Aug 2021

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view over Cerritos Beach, Baja California Sur, with dark blue ocean at left, white surf along the sand, green inland fields, scattered buildings, distant hills, and no visible people.
The opening frame gives a wide coastal overview with the beach edge and inland rural grid visible together. (0:00)
Wide drone frame of Cerritos Beach showing the surf line running diagonally below the ocean, a patchwork of green fields and dirt roads inland, distant hills, and no visible people.
This moment keeps the coastline prominent while showing how the rural road network spreads inland. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.