Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Underwater Seabed with Rocky Formations and Fish (Palmilla los Cabos, 2021)

6s 4K UHD 59.96fps Ocean Palmilla los Cabos, Baja California Sur, Mexico 2021
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The video shows an underwater view of a rocky seabed covered in algae. Small fish swim near the rocks and across the frame. The camera moves slowly, revealing different sections of the ocean floor.

Clip Intelligence

Production use
Travel editors, documentary producers, agency mood reels, brand films, and social cuts can use this Palmilla Los Cabos underwater clip for natural marine texture with rocks, algae, and small fish.
Edit role
At about six seconds, the clip works as a short cutaway, insert, or transition beat between beach, snorkeling, reef, or ocean-floor moments in a larger Los Cabos sequence.
Visual details
The frames show green-yellow clear water over a rocky seabed, algae-coated formations in the foreground and midground, small dark fish near the rocks, rippled sunlight on stone, and no visible people.
Shot mechanics
The composition stays underwater at seabed level, with textured rocks filling the foreground and midground while the water column and occasional fish sit behind them.

Tags

underwaterseabedrocksalgaefishswimmingmarinegreenyellowclear watermovementocean flooraquaticnaturalcalmcoralreefocean

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.264 MP4
File size
63 MB
Location
Palmilla Los Cabos, Baja California Sur, Mexico
Year filmed
2021
Published
Jan 2021

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Algae-coated rocky seabed in Palmilla Los Cabos, Baja California Sur, with green water, rippled sunlight, small dark fish near the rocks, and no visible people.
The opening frame shows the clip's underwater rock texture and small fish presence. (0:00)
Large rounded rock formation on the Palmilla Los Cabos seabed, covered in algae with green water above, a small dark fish behind it, and no visible people.
This moment keeps the main rocky formation centered for an underwater seabed insert. (0:01)
Closer view of an algae-coated rounded rock on the Palmilla Los Cabos ocean floor, with yellow-green sunlight across surrounding stones and no visible people.
The frame gives buyers a tighter look at the textured rock and light pattern underwater. (0:02)
Rocky underwater slope with algae and a small dark fish crossing open water.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.