Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

PALMILLA LOS CABOS BCS MEXICO-2021: Underwater Seabed with Rocky Formations and Fish

6s 4K UHD Palmilla Los Cabos, Baja California Sur, Mexico 2021
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The video shows an underwater view of a rocky seabed covered in algae. Small fish swim near the rocks and across the frame. The camera moves slowly, revealing different sections of the ocean floor.

Clip Intelligence

Production use
Travel editors, documentary producers, agency mood reels, brand films, and social cuts can use this Palmilla Los Cabos underwater clip for natural marine texture with rocks, algae, and small fish.
Edit role
At about six seconds, the clip works as a short cutaway, insert, or transition beat between beach, snorkeling, reef, or ocean-floor moments in a larger Los Cabos sequence.

Tags

PALMILLA LOS CABOS BCS MEXICO2021underwaterseabedrocksalgaefishswimmingmarinegreenyellowclear watermovementocean flooraquaticnaturalcalmcoralreefocean

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Palmilla Los Cabos, Baja California Sur, Mexico
Year filmed
2021
Published
Jan 2021

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Algae-coated rocky seabed in Palmilla Los Cabos, Baja California Sur, with green water, rippled sunlight, small dark fish near the rocks, and no visible people.
The opening frame shows the clip's underwater rock texture and small fish presence. (0:00)
Large rounded rock formation on the Palmilla Los Cabos seabed, covered in algae with green water above, a small dark fish behind it, and no visible people.
This moment keeps the main rocky formation centered for an underwater seabed insert. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.