Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Dusk Over River and Town From Above (San Carlos, 2022)

6s 4K UHD 29.97fps Aerial San Carlos, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A river flows past a small town with greenery along its banks. The sky displays a pink and blue gradient, indicating dusk. The water remains calm, reflecting the soft light of the evening sky.

Clip Intelligence

Production use
Aerial dusk footage for travel edits, coastal documentary sequences, agency mood reels, brand films, or social cuts needing San Carlos, Baja California Sur water and town context.
Edit role
Use this 6-second clip as a quiet opener, location cutaway, or transition beat between beach, ocean, and town material in a San Carlos coastal sequence.
Visual details
Wide water fills the foreground, green shoreline vegetation frames the banks, a small town sits on a low peninsula, and a pink to blue dusk sky stretches above with no visible people.
Shot mechanics
The view is from a high aerial drone position with water in the foreground, town and shoreline in the midground, and a level distant horizon under a broad evening sky.

Tags

rivertownwaterskypinkblueduskaerialgreenerylandscapecalmreflectionshorebuildingsvegetationaerial viewsunrisecoastal town

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
76 MB
Location
San Carlos, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

High aerial view of San Carlos, Baja California Sur at dusk, with calm water in front, green riverbank vegetation, a small town on the right, and no visible people.
The opening frame establishes the town, water, and pink-blue evening sky from above. (0:00)
Aerial dusk frame over San Carlos, Baja California Sur, showing the broad water channel, dark green bank in the lower foreground, town buildings to the right, and no visible people.
This second moment keeps the river or inlet dominant while holding the town as midground context. (0:01)
Drone-height view of San Carlos, Baja California Sur with calm water occupying most of the frame, a compact town on the right shoreline, low green banks, and no visible people.
The frame offers a wide geography cutaway with water scale and town placement clearly visible. (0:02)
Dusk aerial over a river mouth or inlet with green banks and town buildings on the right.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.