Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN CARLOS BCS MEXICO-2022: Dusk Over River and Town From Above

6s 4K UHD San Carlos, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A river flows past a small town with greenery along its banks. The sky displays a pink and blue gradient, indicating dusk. The water remains calm, reflecting the soft light of the evening sky.

Clip Intelligence

Production use
Aerial dusk footage for travel edits, coastal documentary sequences, agency mood reels, brand films, or social cuts needing San Carlos, Baja California Sur water and town context.
Edit role
Use this 6-second clip as a quiet opener, location cutaway, or transition beat between beach, ocean, and town material in a San Carlos coastal sequence.

Tags

SAN CARLOS BCS MEXICO2022rivertownwaterskypinkblueduskaerialgreenerylandscapecalmreflectionshorebuildingsvegetationaerial viewsunrisecoastal town

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
San Carlos, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

High aerial view of San Carlos, Baja California Sur at dusk, with calm water in front, green riverbank vegetation, a small town on the right, and no visible people.
The opening frame establishes the town, water, and pink-blue evening sky from above. (0:00)
Wide aerial view of water curving around a vegetated shore with a town beyond at dusk.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.