Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN CARLOS BCS MEXICO-2022: Coastal River and Town at Dusk

8s 4K UHD San Carlos, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A slow aerial view of a wide river curving past a coastal town. The sky shows soft pink and blue hues of dusk. Calm water reflects the sky, bordered by green vegetation and developed areas.

Clip Intelligence

Production use
Aerial San Carlos, Baja California Sur footage fits travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing a river-town dusk view in Mexico.
Edit role
Use this 8-second aerial view as a calm opener, transition, or closing beat between beach, ocean, and town coverage in a San Carlos sequence.

Tags

SAN CARLOS BCS MEXICO2022rivertowncoastaldusksunsetskywatergreeneryaerialcalmpinkbluelandscapereflectionserenenaturalsunrisehorizon

Shot slate

Resolution
4K UHD
Duration
8s
Codec
H.264 MP4
Location
San Carlos, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial dusk view over San Carlos, Baja California Sur, with a broad river curving past green vegetation and a coastal town under a pink and blue sky, no visible people.
The opening frame sets the river, shoreline vegetation, and town in a wide dusk composition. (0:00)
Wide aerial view of calm water, green shoreline, and town under pink dusk light.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.