Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Coastal River and Town at Dusk (San Carlos, 2022)

8s 4K UHD 29.97fps Sunset San Carlos, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A slow aerial view of a wide river curving past a coastal town. The sky shows soft pink and blue hues of dusk. Calm water reflects the sky, bordered by green vegetation and developed areas.

Clip Intelligence

Production use
Aerial San Carlos, Baja California Sur footage fits travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing a river-town dusk view in Mexico.
Edit role
Use this 8-second aerial view as a calm opener, transition, or closing beat between beach, ocean, and town coverage in a San Carlos sequence.
Visual details
Frames show a wide river or inlet curving between green vegetation and a developed coastal town, with calm water, a low horizon, pink and blue dusk sky, and no visible people.
Shot mechanics
The composition is an elevated drone perspective with water in the center, green shoreline in the foreground, the town in the midground, and a level dusk horizon in the background.

Tags

rivertowncoastaldusksunsetskywatergreeneryaerialcalmpinkbluelandscapereflectionserenenaturalsunrisehorizon

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
8s
Codec
H.265 (HEVC) MP4
File size
101 MB
Location
San Carlos, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial dusk view over San Carlos, Baja California Sur, with a broad river curving past green vegetation and a coastal town under a pink and blue sky, no visible people.
The opening frame sets the river, shoreline vegetation, and town in a wide dusk composition. (0:00)
San Carlos, Baja California Sur appears from above with calm water centered in frame, dark green vegetation in the foreground, and the town stretching along the far shore, no visible people.
This frame emphasizes the wide water channel leading the eye toward the developed shoreline. (0:01)
A high aerial frame over San Carlos, Baja California Sur shows the river bend, a small vegetated island near the lower left, the town along the far bank, and a pastel dusk horizon, no visible people.
The small island and curving banks give this moment useful geography within the wide aerial view. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.