Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN PANCHO NAYARIT MEXICO-2022: Group Hiking Along a Forest Trail

6s 4K UHD San Pancho, Nayarit, Mexico 2022
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A group of three people, including a child, walk along a dirt path in a dense forest. The path is surrounded by tall trees and lush green foliage. Sunlight filters through the canopy, casting dappled shadows on the ground as they move forward.

Clip Intelligence

Production use
Useful for travel edits, documentary sequences, brand films, and social cuts needing a small group hiking through forest in San Pancho, Nayarit, Mexico.
Edit role
Works as a six-second walking beat, trail cutaway, or transition between beach and nature moments in a San Pancho travel or family-outdoor sequence.

Tags

SAN PANCHO NAYARIT MEXICO2022foresttrailhikinggroupchildadultswalkingdirtpathgreenerytreesfoliagesunlightshadowsnatureoutdoormovementfamily

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
San Pancho, Nayarit, Mexico
Year filmed
2022
Published
Nov 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A child in a pale shirt walks away on a dirt forest path in San Pancho, Nayarit, Mexico, with adults partly visible at both edges and sunlight on the trail.
The opening frame places the viewer behind a small group starting down the forest trail. (0:00)
Child walking ahead on a bright dirt trail

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.