Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Group Hiking Along a Forest Trail (San Pancho, 2022) · clip 2 of 2

6s 4K UHD 59.96fps Forest San Pancho, Nayarit, Mexico 2022
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A group of three people, including a child, walk along a dirt path in a dense forest. The path is surrounded by tall trees and lush green foliage. Sunlight filters through the canopy, casting dappled shadows on the ground as they move forward.

Clip Intelligence

Production use
Useful for travel edits, documentary sequences, brand films, and social cuts needing a small group hiking through forest in San Pancho, Nayarit, Mexico.
Edit role
Works as a six-second walking beat, trail cutaway, or transition between beach and nature moments in a San Pancho travel or family-outdoor sequence.
Visual details
Three people, including a child, walk away from camera on a dirt forest path with dense green foliage, tall trunks, dry leaf litter, and bright dappled sunlight across the ground.
Shot mechanics
The camera is positioned behind the hikers at standing height, with the child in the midground, adults entering from the sides, and the trail drawing the eye into shaded forest.

Tags

foresttrailhikinggroupchildadultswalkingdirtpathgreenerytreesfoliagesunlightshadowsnatureoutdoormovementfamily

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
39 MB
Location
San Pancho, Nayarit, Mexico
Year filmed
2022
Published
Nov 2020

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A child in a pale shirt walks away on a dirt forest path in San Pancho, Nayarit, Mexico, with adults partly visible at both edges and sunlight on the trail.
The opening frame places the viewer behind a small group starting down the forest trail. (0:00)
The child continues along the sunlit dirt path in San Pancho, Nayarit, Mexico, while an adult in dark pants remains cropped at the right edge of the forest scene.
This frame emphasizes the trail direction and the child moving farther into the vegetation. (0:01)
A child walks between two partly cropped adults on a dirt path in San Pancho, Nayarit, Mexico, with thick foliage and bright sunlight breaking through the canopy.
The third frame shows the group tighter together as the path bends through dense forest. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.