Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Hikers Walking Along a Forest Path (San Pancho, 2022)

6s 4K UHD 59.96fps Forest San Pancho, Nayarit, Mexico 2022
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A group of people walks along a narrow dirt path in a dense forest. The trail is surrounded by lush green plants and trees. Sunlight filters through the canopy, casting dappled shadows on the ground.

Clip Intelligence

Production use
Travel editors, documentary producers, agency mood reels, brand films, and social cuts can use this San Pancho forest hiking clip to show people moving through a shaded outdoor trail in Mexico.
Edit role
Use this 6-second clip as a walking cutaway, transition beat, or connective insert between beach, village, and forest moments in a San Pancho travel or documentary sequence.
Visual details
A person in a pale shirt and dark leggings walks away from camera on a narrow dirt trail, with other hikers ahead, dense green foliage, large tree trunks, rocks, dry leaves, and dappled sunlight.

Tags

foresttrailhikingpeoplewalkingdirtpathgreenerytreesfoliagenaturegroupoutdoorsunlightshadowsmovementhikersadventure

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
39 MB
Location
San Pancho, Nayarit, Mexico
Year filmed
2022
Published
Nov 2020

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

At 0:00, hikers walk away from the camera on a dirt forest path in San Pancho, Nayarit, with bright sun on the nearest walker and dense foliage around the trail.
The opening frame shows the group already moving along the narrow shaded trail. (0:00)
At 0:01, the nearest hiker is centered from behind on the San Pancho forest trail while other walkers move ahead through darker vegetation and broken sunlight.
This frame gives a centered follow-behind view with the path drawing the eye into the trees. (0:01)
At 0:02, the nearest walker continues uphill on the dirt path in San Pancho, with a large tree trunk on the right, loose rocks, and hikers farther ahead in the shade.
The frame emphasizes the uneven trail surface and the scale of the surrounding trees. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.