Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN PANCHO NAYARIT MEXICO-2022: Hikers Walking Along a Forest Path

6s 4K UHD San Pancho, Nayarit, Mexico 2022
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A group of people walks along a narrow dirt path in a dense forest. The trail is surrounded by lush green plants and trees. Sunlight filters through the canopy, casting dappled shadows on the ground.

Clip Intelligence

Production use
Travel editors, documentary producers, agency mood reels, brand films, and social cuts can use this San Pancho forest hiking clip to show people moving through a shaded outdoor trail in Mexico.
Edit role
Use this 6-second clip as a walking cutaway, transition beat, or connective insert between beach, village, and forest moments in a San Pancho travel or documentary sequence.

Tags

SAN PANCHO NAYARIT MEXICO2022foresttrailhikingpeoplewalkingdirtpathgreenerytreesfoliagenaturegroupoutdoorsunlightshadowsmovementhikersadventure

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
San Pancho, Nayarit, Mexico
Year filmed
2022
Published
Nov 2020

Still Frames From This Clip

One frame exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

At 0:00, hikers walk away from the camera on a dirt forest path in San Pancho, Nayarit, with bright sun on the nearest walker and dense foliage around the trail.
The opening frame shows the group already moving along the narrow shaded trail. (0:00)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.