Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

EL TULE LOS CABOS BCS MEXICO-2022: Shifting Foamy Patterns on Ocean Surface

7s 4K UHD El Tule Los Cabos, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The ocean surface displays shifting foamy patterns. White bubbles and ripples move across the turquoise water. The water remains calm with gentle motion.

Clip Intelligence

Production use
Useful for travel edits, documentary texture, agency mood reels, brand films, or social cuts needing calm turquoise ocean surface detail from El Tule Los Cabos, Baja California Sur.
Edit role
This 7-second clip works as a short cutaway, transition, or visual texture between beach, shoreline, or aerial water shots in a coastal sequence.

Tags

EL TULE LOS CABOS BCS MEXICO2022oceanwatersurfacefoamripplesturquoisebluemovementchangingwhitebubblesdynamicseacalmwavesripplemarineaerial

Shot slate

Resolution
4K UHD
Duration
7s
Codec
H.264 MP4
Location
El Tule Los Cabos, Baja California Sur, Mexico
Year filmed
2022
Published
Feb 2022

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Turquoise ocean surface at El Tule Los Cabos with scattered white foam rings and no visible people.
The opening frame gives a clean overhead look at turquoise water with small foam patterns. (0:00)
White circular foam pattern on rippled turquoise water.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.