Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Shifting Foamy Patterns on Ocean Surface (El Tule los Cabos, 2022)

7s 4K UHD 29.97fps Ocean El Tule los Cabos, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The ocean surface displays shifting foamy patterns. White bubbles and ripples move across the turquoise water. The water remains calm with gentle motion.

Clip Intelligence

Production use
Useful for travel edits, documentary texture, agency mood reels, brand films, or social cuts needing calm turquoise ocean surface detail from El Tule Los Cabos, Baja California Sur.
Edit role
This 7-second clip works as a short cutaway, transition, or visual texture between beach, shoreline, or aerial water shots in a coastal sequence.
Visual details
The frames show turquoise ocean water filling the image, with white foam rings, small bubbles, ripples, and darker patches under the surface, with no visible people.
Shot mechanics
The composition stays tight on the water surface with no horizon, shoreline, vessels, or foreground objects visible, and the drone hint is consistent with the overhead ocean view.

Tags

oceanwatersurfacefoamripplesturquoisebluemovementchangingwhitebubblesdynamicseacalmwavesripplemarineaerial

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
7s
Codec
H.264 MP4
File size
86 MB
Location
El Tule Los Cabos, Baja California Sur, Mexico
Year filmed
2022
Published
Feb 2022

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Turquoise ocean surface at El Tule Los Cabos with scattered white foam rings and no visible people.
The opening frame gives a clean overhead look at turquoise water with small foam patterns. (0:00)
A white circular foam pattern sits near the center of the turquoise water at El Tule Los Cabos, with no visible people.
This moment centers on a distinct circular foam mark against the blue-green sea surface. (0:01)
Turquoise water at El Tule Los Cabos shows a loose white foam swirl across the rippled surface, with no visible people.
The frame shows the foam breaking into a looser swirl as the water texture shifts. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.