Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

BAJA CALIFORNIA MEXICO-2022: Whale Surfacing near Boat in Ocean

7s 4K UHD Baja California, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A large whale surfaces in the ocean near a boat. The whale's back and head emerge from the water, creating splashes. The sequence shows the whale moving through the water, viewed from the boat's edge.

Clip Intelligence

Production use
Useful for wildlife documentary, travel edit, conservation segment, agency mood reel, or social cut needing a whale surfacing beside a boat in Baja California, Mexico.
Edit role
The seven-second shot works as a quick insert or cutaway between wider ocean coverage and reaction shots, holding on the whale breaking the surface near the boat.

Tags

BAJA CALIFORNIA MEXICO2022whaleoceanwaterboatsurfacingmarineanimalseawavessplashingbluegreenmovementlifeopendolphinswimsurface

Shot slate

Resolution
4K UHD
Duration
7s
Codec
H.264 MP4
Location
Baja California, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A dark whale shape moves just under the blue-green water beside the white edge of a boat in Baja California, Mexico, with sun sparkles on small waves and no visible people.
This opening frame shows the whale close to the boat before the surface break becomes clearer. (0:00)
Dark whale back under rippled water with boat edge in the foreground.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.