Low-resolution preview (256x144) for evaluation. The licensed download is the clean 2.7K master at the stated resolution.

Download the free low-res preview to test in your edit

Whale Surfacing near Boat in Ocean (Baja California, 2022)

7s 2.7K 29.97fps Wildlife Baja California, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A large whale surfaces in the ocean near a boat. The whale's back and head emerge from the water, creating splashes. The sequence shows the whale moving through the water, viewed from the boat's edge.

Clip Intelligence

Production use
Useful for wildlife documentary, travel edit, conservation segment, agency mood reel, or social cut needing a whale surfacing beside a boat in Baja California, Mexico.
Edit role
The seven-second shot works as a quick insert or cutaway between wider ocean coverage and reaction shots, holding on the whale breaking the surface near the boat.
Visual details
Blue-green ocean fills the frame, a white boat edge cuts through the foreground, and the dark back of a whale surfaces under bright sun with splashes and no visible people.
Shot mechanics
The composition is shot from the edge of a boat with the hull or deck corner in the foreground, choppy water in the midground, and a low horizon or distant coast appearing briefly near the end.

Tags

whaleoceanwaterboatsurfacingmarineanimalseawavessplashingbluegreenmovementlifeopendolphinswimsurface

Shot slate

Resolution
2704 × 1520
Frame rate
29.97 fps
Duration
7s
Codec
H.265 (HEVC) MP4
File size
39 MB
Location
Baja California, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A dark whale shape moves just under the blue-green water beside the white edge of a boat in Baja California, Mexico, with sun sparkles on small waves and no visible people.
This opening frame shows the whale close to the boat before the surface break becomes clearer. (0:00)
The whale's dark back sits beneath rippled turquoise water while a bright white boat corner anchors the foreground in Baja California, Mexico, with no visible people.
The frame gives editors a close boat-side view of the animal moving through the water. (0:01)
A dark whale form is visible below the sunlit ocean surface near a white boat edge in Baja California, Mexico, with brighter glare around the foreground and no visible people.
This moment shows the whale passing close enough for its body shape to read through the water. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant download of the 2.7K master with a license PDF, direct from filmmaker Phil Maher.