Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

Shifting Beach Dunes and Ocean Waves

6s 4K UHD San Jose Del Cabo, Baja California Sur, Mexico 2022
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

The sandy beach stretches along the ocean with gentle waves. A grassy dune area shows subtle movement between frames. People walk along the shore, and the sky has scattered clouds.

Clip Intelligence

Production use
Fits a travel edit, coastal documentary, agency mood reel, brand film, or social cut needing a 2022 aerial view of San Jose del Cabo beach, ocean surf, dunes, and resort-area buildings.
Edit role
Use as a six-second opener, transition, or geographic cutaway between tighter beach, hotel, or shoreline moments in a Mexico travel or destination sequence.

Tags

1927beachsandoceanwavesdunesgrassgreenblueskycloudspeoplewalkingshiftingaerialgreenerybuildingsmountainslandscapedrone

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
San Jose Del Cabo, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view over a San Jose del Cabo beach with white surf on the left, green dune vegetation in front, low buildings to the right, mountains beyond, and tiny people on the sand.
The opening frame sets the shoreline layout with ocean, dunes, buildings, and mountains visible together. (0:00)
Wide drone view along beach with surf, dune grass, buildings, hills, and scattered clouds.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.