Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Shifting Beach Dunes and Ocean Waves (San Jose del Cabo, 2022)

6s 4K UHD 29.97fps Aerial San Jose del Cabo, Baja California Sur, Mexico 2022
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

The sandy beach stretches along the ocean with gentle waves. A grassy dune area shows subtle movement between frames. People walk along the shore, and the sky has scattered clouds.

Clip Intelligence

Production use
Fits a travel edit, coastal documentary, agency mood reel, brand film, or social cut needing a 2022 aerial view of San Jose del Cabo beach, ocean surf, dunes, and resort-area buildings.
Edit role
Use as a six-second opener, transition, or geographic cutaway between tighter beach, hotel, or shoreline moments in a Mexico travel or destination sequence.
Visual details
A wide sandy beach fills the frame with blue ocean and white surf on the left, green dune vegetation in the foreground, low buildings and palms to the right, mountains in back, scattered clouds, and tiny people visible on the sand.
Shot mechanics
The frames support an aerial drone viewpoint looking diagonally along the shoreline, with dune grass in the foreground, beach and water through the midground, and a level horizon of buildings, hills, and sky.

Tags

beachsandoceanwavesdunesgrassgreenblueskycloudspeoplewalkingshiftingaerialgreenerybuildingsmountainslandscapedrone

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
76 MB
Location
San Jose Del Cabo, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view over a San Jose del Cabo beach with white surf on the left, green dune vegetation in front, low buildings to the right, mountains beyond, and tiny people on the sand.
The opening frame sets the shoreline layout with ocean, dunes, buildings, and mountains visible together. (0:00)
Wide aerial frame of San Jose del Cabo coastline showing the beach curving into the distance, ocean surf to the left, dune grass below, buildings and palms on the right, and small walkers on the sand.
This frame keeps the beach broad and open while showing light pedestrian activity near the shoreline. (0:01)
Aerial view in San Jose del Cabo with more open sand visible in the foreground, a patch of green dunes on the lower right, blue ocean and breaking waves at left, and distant people near the beach buildings.
The third frame emphasizes the width of the sand and the separation between surf, dune vegetation, and developed beachfront. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.