Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Whale Surfacing and Spouting in Turquoise Water (Buzzards Beach, 2023) · clip 5 of 5

6s 4K UHD 29.97fps Wildlife Buzzards Beach, Baja California Sur, Mexico 2023
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A whale swims in clear turquoise water. It surfaces, exhaling a spray of water from its blowhole. The sequence captures the whale's movement and spout in the ocean.

Clip Intelligence

Production use
Useful for wildlife documentary, Baja California Sur travel edits, conservation pieces, brand films, or social cuts needing an overhead whale moment in clear turquoise ocean water.
Edit role
The six-second shot works as a short cutaway, transition beat, or insert between shoreline views and wider marine-life coverage, with the spout providing the main visual payoff near the end.
Visual details
An overhead view shows a whale moving through clear turquoise water, with white surface turbulence along its body and a visible blowhole spray in the final frame, and no people are visible.
Shot mechanics
The composition is aerial and top-down, consistent with drone capture, keeping the whale centered against open water with no horizon, shoreline, boats, or foreground objects in frame.

Tags

whaleoceanwaterturquoisesurfacingspoutingblowholespraymarineanimalwildlifeclearcalmmovementaerialoverheadseamarine life

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
92 MB
Location
Buzzards Beach, Baja California Sur, Mexico
Year filmed
2023
Published
Jun 2026

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead frame from Buzzards Beach, Baja California Sur, showing a whale below clear turquoise water with a white surface trail and no visible people.
The opening frame establishes the whale as a pale moving shape beneath open turquoise water. (0:00)
Overhead Buzzards Beach frame with the whale angled through turquoise water, its bright wake spread wider near the head and no visible people.
This moment keeps the whale centered in open water as the surface trail thickens around the body. (0:01)
Aerial view at Buzzards Beach showing the whale continuing through clear turquoise ocean, with a narrow tailward shadow and no visible people.
The frame shows the whale's progress across otherwise empty water before the surfacing moment. (0:02)
Overhead frame from Buzzards Beach with the whale partially lower in the composition, white turbulence marking its path through turquoise water and no visible people.
The whale shifts lower in the frame, leaving a bright trail against the uncluttered ocean surface. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.