Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

BUZZARDS BEACH EAST CAPE BCS-2023: Whale Surfacing and Spouting in Turquoise Water

6s 4K UHD Buzzards Beach, Baja California Sur, Mexico 2023
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A whale swims in clear turquoise water. It surfaces, exhaling a spray of water from its blowhole. The sequence captures the whale's movement and spout in the ocean.

Clip Intelligence

Production use
Useful for wildlife documentary, Baja California Sur travel edits, conservation pieces, brand films, or social cuts needing an overhead whale moment in clear turquoise ocean water.

Tags

BUZZARDS BEACH EAST CAPE BCS2023whaleoceanwaterturquoisesurfacingspoutingblowholespraymarineanimalwildlifeclearcalmmovementaerialoverheadseamarine life

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Buzzards Beach, Baja California Sur, Mexico
Year filmed
2023
Published
Jun 2026

Still Frames From This Clip

One frame exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Whale just below turquoise ocean surface with white wake.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.