Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

School of Fish Forming a Dynamic Spiral in Clear Water (Buzzards Beach, 2023)

6s 4K UHD 29.97fps Wildlife Buzzards Beach, Baja California Sur, Mexico 2023
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A large school of fish swims in a continuous spiral pattern. The fish move in unison, creating a dynamic, circular formation in the clear turquoise water. The motion is fluid and coordinated, with the school maintaining its shape as it rotates.

Clip Intelligence

Production use
Useful for wildlife documentaries, Baja California Sur travel edits, conservation pieces, agency mood reels, and social cuts needing an aerial view of schooling fish in clear turquoise ocean water.
Edit role
The six-second shot works as a marine life insert, rhythmic transition, or visual texture beat between shoreline aerials and underwater or swimmer material from the same Buzzards Beach sequence.
Visual details
A large school of small fish forms a loose rotating spiral beneath clear turquoise water, with bright surface ripples crossing the frame and no visible people, boats, logos, or shoreline.
Shot mechanics
The frames support an overhead aerial composition looking straight down into shallow water, likely from a drone, with the fish occupying the mid-frame and water texture filling the full 4K image.

Tags

fishschoolswirlingspiralwaterturquoiseoceanmovementclearmarineaquaticgroupswimmingpatterndynamicwavesaerialripple

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
91 MB
Location
Buzzards Beach, Baja California Sur, Mexico
Year filmed
2023
Published
Jun 2026

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead frame from Buzzards Beach, Baja California Sur, showing a school of fish bending into a broad spiral beneath turquoise water with bright ripples and no visible people.
The opening frame shows the fish school already arranged in a wide rotating curve under clear water. (0:00)
At Buzzards Beach in Baja California Sur, the fish school appears more tightly gathered into a circular swirl under green-blue water with sunlit surface texture and no visible people.
This frame emphasizes the denser middle of the spiral as the school curves through the water. (0:01)
Overhead view at Buzzards Beach, Baja California Sur, with the fish school arcing into a rounded spiral near the upper part of the frame and open turquoise water below, no visible people.
The third frame gives editors a clean view of the spiral shape against open water. (0:02)
Buzzards Beach overhead frame showing the school stretched into a longer curved band across clear turquoise water, with soft wave shadows and no visible people.
This moment shows the school elongating, useful as a textural insert with visible coordinated movement. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.