Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

BUZZARDS BEACH EAST CAPE BCS-2023: School of Fish Forming a Dynamic Spiral in Clear Water

6s 4K UHD Buzzards Beach, Baja California Sur, Mexico 2023
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A large school of fish swims in a continuous spiral pattern. The fish move in unison, creating a dynamic, circular formation in the clear turquoise water. The motion is fluid and coordinated, with the school maintaining its shape as it rotates.

Clip Intelligence

Production use
Useful for wildlife documentaries, Baja California Sur travel edits, conservation pieces, agency mood reels, and social cuts needing an aerial view of schooling fish in clear turquoise ocean water.
Edit role
The six-second shot works as a marine life insert, rhythmic transition, or visual texture beat between shoreline aerials and underwater or swimmer material from the same Buzzards Beach sequence.
Visual details
A large school of small fish forms a loose rotating spiral beneath clear turquoise water, with bright surface ripples crossing the frame and no visible people, boats, logos, or shoreline.

Tags

BUZZARDS BEACH EAST CAPE BCS2023fishschoolswirlingspiralwaterturquoiseoceanmovementclearmarineaquaticgroupswimmingpatterndynamicwavesaerialripple

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Buzzards Beach, Baja California Sur, Mexico
Year filmed
2023
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Overhead frame from Buzzards Beach, Baja California Sur, showing a school of fish bending into a broad spiral beneath turquoise water with bright ripples and no visible people.
The opening frame shows the fish school already arranged in a wide rotating curve under clear water. (0:00)
At Buzzards Beach in Baja California Sur, the fish school appears more tightly gathered into a circular swirl under green-blue water with sunlit surface texture and no visible people.
This frame emphasizes the denser middle of the spiral as the school curves through the water. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.