Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

PUERTO LOS CABOS BEACH BCS-2023: Coastal Waves Breaking on Sandy Shore

6s 4K UHD Puerto Los Cabos Beach, Baja California Sur, Mexico 2023
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The sequence captures gentle ocean waves moving toward the sandy shore. Whitecaps form and dissipate in the turquoise water. The beach is bordered by greenery and distant hills under a partly cloudy sky.

Clip Intelligence

Production use
Useful for travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing aerial 4K shoreline coverage from Puerto Los Cabos Beach in Baja California Sur.

Tags

PUERTO LOS CABOS BEACH BCS2023oceanwavessandyshoreturquoisewatercoastalshorelineaerialmovingwhitecapscalmseagreeneryhillscoastlinesanddunes

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Puerto Los Cabos Beach, Baja California Sur, Mexico
Year filmed
2023
Published
Jun 2026

Still Frames From This Clip

One frame exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.