Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Coastal Waves Breaking on Sandy Shore (Puerto los Cabos Beach, 2023)

6s 4K UHD 29.97fps Beach Puerto los Cabos Beach, Baja California Sur, Mexico 2023
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The sequence captures gentle ocean waves moving toward the sandy shore. Whitecaps form and dissipate in the turquoise water. The beach is bordered by greenery and distant hills under a partly cloudy sky.

Clip Intelligence

Production use
Useful for travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing aerial 4K shoreline coverage from Puerto Los Cabos Beach in Baja California Sur.
Edit role
The six-second clip works as a short coastal opener, transition, or breathing-space cutaway between tighter beach, breakwater, resort, or ocean details.
Visual details
Turquoise ocean fills the foreground, small whitecaps move toward a wide sandy beach, green vegetation lines the shore, distant low hills sit beyond the coastline, and no people are visible.
Shot mechanics
The frames support an aerial drone perspective with a high oblique view, ocean in the foreground, beach and greenery through the midground, and a hazy horizon with hills in the background.

Tags

oceanwavessandyshoreturquoisewatercoastalshorelineaerialmovingwhitecapscalmseagreeneryhillscoastlinesanddunes

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
91 MB
Location
Puerto Los Cabos Beach, Baja California Sur, Mexico
Year filmed
2023
Published
Jun 2026

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A high aerial view over Puerto Los Cabos Beach shows turquoise water in the foreground, a pale sandy shoreline curving into the distance, green vegetation inland, distant hills, and no visible people.
The opening frame sets the coastal geography with ocean, sand, greenery, and hills in one wide view. (0:00)
At 0:01, Puerto Los Cabos Beach remains in a wide aerial composition, with whitecaps scattered across the turquoise water, the sandy beach running diagonally, inland greenery, distant hills, and no visible people.
This frame emphasizes the diagonal shoreline and small whitecaps moving toward the beach. (0:01)
At 0:02, the aerial view of Puerto Los Cabos Beach shows more open water in the foreground, thin surf along the pale sand, a green band behind the beach, low hills on the horizon, and no visible people.
The frame gives editors a clean ocean-forward view with the beach receding toward the hills. (0:02)
At 0:03, Puerto Los Cabos Beach is seen from above with a longer stretch of surf line visible, turquoise water filling the left foreground, pale sand on the right, inland greenery, distant hills, and no visible people.
This moment shows the coastline stretching farther across the frame for a broad transition shot. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.