Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN IGNACIO BCS MEXICO-2023: Palm Forest With A Road In The Middle

6s 4K UHD 29.97fps San Ignacio, Baja California Sur, Mexico 2023
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Shot from a aerial in 2023, this vintage film footage captures a striking palm forest in San Ignacio, BCS, Mexico. A narrow road winds through the lush greenery, contrasting with the surrounding arid mountains and desert landscape. The scene unfolds under a clear sky, showcasing an oasis-like environment with dense palm trees, scattered plants, and rugged terrain. No humans appear in the frame, emphasizing the natural beauty and isolation of this remote Mexican landscape. The footage evokes a sense of tranquility and discovery, blending desert resilience with tropical abundance. Ideal for documentaries, travel content, or projects exploring Mexican geography and rasquache culture.

Clip Intelligence

Production use
Useful for travel edits, documentary geography segments, agency mood reels, or brand films needing an aerial view of San Ignacio, Baja California Sur, with palm growth set against desert hills.
Edit role
This short clip works as an opener, transition, or location texture before moving into closer shots of the road, water, town, or palm grove in the same San Ignacio sequence.
Visual details
The frame shows a dense palm forest, a narrow road cutting through the trees, a reflective water edge at right, low desert hills in the distance, warm daylight, and no visible people.
Shot mechanics
The composition is an elevated aerial view with palms filling the foreground and midground, the road running through the center, water on the right edge, and a broad horizon of arid hills.

Tags

SANignacioBCSmexico2023rasquachearid mountains and palm forestoasis in the desertshot from a dronesceneryno humansoutdoorsnaturelandscapeskyfieldplanttreedaymountain

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
75 MB
Location
San Ignacio, Baja California Sur, Mexico
Year filmed
2023
Published
Jun 2026

Still Frames From This Clip

One frame exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view over a dense palm forest in San Ignacio, Baja California Sur, with a narrow road through the trees, water at the right edge, desert hills beyond, and no visible people.
The frame shows the clip's main aerial composition, a palm-filled oasis landscape with a road running through it. (0:00)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.