Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

PLAYA ACAPULQUITO LOS CABOS BCS MEXICO-2021: Coastal Beach with Buildings and Clear Ocean

6s 4K UHD Playa Acapulquito Los Cabos, Baja California Sur, Mexico 2021
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A coastal scene features a sandy beach, buildings along the shore, and clear blue ocean water. The camera moves downward, revealing more of the beach and a rocky outcrop on the left. Calm waves gently lap the shore under a clear sky.

Clip Intelligence

Production use
Use this 4K coastal drone view for travel edits, Baja California Sur documentary context, agency mood reels, brand films, or social cuts needing Playa Acapulquito shoreline, clear water, sand, rocks, and beachfront buildings.
Edit role
The six-second clip works as a brief opener, location transition, or coastal cutaway between tighter beach and underwater shots from the same Playa Acapulquito sequence.

Tags

PLAYA ACAPULQUITO LOS CABOS BCS MEXICO2021beachoceanbuildingssandwaterclearbluecoastalshorerockycliffaerialviewcalmwavescityscapeturquoisecoastline

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Playa Acapulquito Los Cabos, Baja California Sur, Mexico
Year filmed
2021
Published
Dec 2021

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Wide aerial view at Playa Acapulquito, Los Cabos, with deep blue ocean filling the frame, a sandy beach and rocky point on the left, shoreline buildings in the distance, and no visible people.
The opening frame gives buyers a broad coastal layout with beach, rocks, ocean, buildings, and hills in one view. (0:00)
Aerial coastline view with clear water, beach, rocks, buildings, and hills.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.