Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Coastal Beach with Buildings and Clear Ocean (Playa Acapulquito los Cabos, 2021)

6s 4K UHD 29.97fps Beach Playa Acapulquito los Cabos, Baja California Sur, Mexico 2021
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A coastal scene features a sandy beach, buildings along the shore, and clear blue ocean water. The camera moves downward, revealing more of the beach and a rocky outcrop on the left. Calm waves gently lap the shore under a clear sky.

Clip Intelligence

Production use
Use this 4K coastal drone view for travel edits, Baja California Sur documentary context, agency mood reels, brand films, or social cuts needing Playa Acapulquito shoreline, clear water, sand, rocks, and beachfront buildings.
Edit role
The six-second clip works as a brief opener, location transition, or coastal cutaway between tighter beach and underwater shots from the same Playa Acapulquito sequence.
Visual details
Frames show turquoise and deep blue ocean, a sandy crescent beach, tan rocky outcrops at left, white and low-rise buildings along the shore, distant hills, bright daylight, light cloud streaks, and no visible people.
Shot mechanics
The composition is an elevated aerial view with rocks and beach in the foreground, open water across the midground, shoreline buildings and hills on the horizon, consistent with the DJI drone camera hint.

Tags

beachoceanbuildingssandwaterclearbluecoastalshorerockycliffaerialviewcalmwavescityscapeturquoisecoastline

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
74 MB
Location
Playa Acapulquito Los Cabos, Baja California Sur, Mexico
Year filmed
2021
Published
Dec 2021

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Wide aerial view at Playa Acapulquito, Los Cabos, with deep blue ocean filling the frame, a sandy beach and rocky point on the left, shoreline buildings in the distance, and no visible people.
The opening frame gives buyers a broad coastal layout with beach, rocks, ocean, buildings, and hills in one view. (0:00)
Aerial frame over Playa Acapulquito showing the beach curve farther left, clear blue-green shallows near the rocks, open ocean to the right, distant buildings, and no visible people.
This second frame keeps the shoreline in context while showing more of the shallow water color near the rocks. (0:01)
High aerial view at Playa Acapulquito with the rocky beach edge low left, a wide field of calm turquoise water, beachfront buildings along the upper shore, hazy hills beyond, and no visible people.
The frame emphasizes the expanse of water while retaining the beach and developed shoreline for location context. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.