Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Coastal Beach with Turquoise Waters and Rocky Shore (Buzzards East Cape los Cabos, 2022)

8s 4K UHD 29.97fps Beach Buzzards East Cape los Cabos, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A coastal beach with turquoise ocean water and sandy shore is shown. Rocky formations line the coastline, with gentle waves meeting the shore. The camera moves forward along the beach, capturing the surrounding hills and clear blue sky.

Clip Intelligence

Production use
Useful for travel edits, coastal documentary segments, agency mood reels, brand films, or social cuts needing a clean aerial view of Buzzards Beach with turquoise water and undeveloped shoreline.
Edit role
Works as an 8-second opener, transition, or geographic cutaway before a beach scene, ocean wildlife sequence, or East Cape location section.
Visual details
The frames show turquoise ocean water, pale sand, rocky shoreline, low green-brown hills, a distant headland, bright daylight, clear blue sky, and no visible people.
Shot mechanics
The DJI drone hint fits the elevated coastal perspective, with a wide composition placing open water in the foreground, beach and rocks in the midground, and hills along the horizon.

Tags

beachoceanturquoisewatersandrocksshorecoastalclearblueskyhillslandscapeaerialcalmwavesmountainscoastline

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
8s
Codec
H.264 MP4
File size
97 MB
Location
Buzzards East Cape Los Cabos, Baja California Sur, Mexico
Year filmed
2022
Published
Jan 2022

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening frame over Buzzards Beach East Cape, Mexico, with turquoise water filling the foreground, pale sand and rocks along the left shoreline, low hills in back, and no visible people.
The clip begins with a broad aerial view of the beach, reef-dark water patches, and dry hills. (0:00)
At 0:01, the Buzzards Beach shoreline remains left of frame while turquoise water spreads across the foreground and a pale headland sits near the right horizon, with no visible people.
This frame gives editors a clean coastline angle with beach, rocks, open water, and a clear horizon. (0:01)
At 0:02, the aerial view shows more open turquoise water in front of the Buzzards Beach sand and rocky edge, with hills stretching across the background and no visible people.
The frame emphasizes the water color and the exposed, undeveloped beach edge. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.