Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

BUZZARDS EAST CAPE LOS CABOS BCS MEXICO-2022: Coastal Beach with Turquoise Waters and Rocky Shore

8s 4K UHD Buzzards East Cape Los Cabos, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A coastal beach with turquoise ocean water and sandy shore is shown. Rocky formations line the coastline, with gentle waves meeting the shore. The camera moves forward along the beach, capturing the surrounding hills and clear blue sky.

Clip Intelligence

Production use
Useful for travel edits, coastal documentary segments, agency mood reels, brand films, or social cuts needing a clean aerial view of Buzzards Beach with turquoise water and undeveloped shoreline.
Edit role
Works as an 8-second opener, transition, or geographic cutaway before a beach scene, ocean wildlife sequence, or East Cape location section.

Tags

BUZZARDS EAST CAPE LOS CABOS BCS MEXICO2022beachoceanturquoisewatersandrocksshorecoastalclearblueskyhillslandscapeaerialcalmwavesmountainscoastline

Shot slate

Resolution
4K UHD
Duration
8s
Codec
H.264 MP4
Location
Buzzards East Cape Los Cabos, Baja California Sur, Mexico
Year filmed
2022
Published
Jan 2022

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening frame over Buzzards Beach East Cape, Mexico, with turquoise water filling the foreground, pale sand and rocks along the left shoreline, low hills in back, and no visible people.
The clip begins with a broad aerial view of the beach, reef-dark water patches, and dry hills. (0:00)
Aerial coastline with beach rocks, turquoise ocean, hills, and distant headland.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.