Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

BUZZARDS EAST CAPE LOS CABOS BCS MEXICO-2022: Humpback Whale Emerging From Ocean Surface

7s 4K UHD Buzzards East Cape Los Cabos, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A humpback whale surfaces in the open ocean, creating splashes and water movement. The whale's head and body emerge from the blue water, with spray and waves visible. The sequence captures the animal's motion as it interacts with the ocean surface.

Clip Intelligence

Production use
Fits wildlife documentary, Baja California Sur travel edit, conservation segment, agency mood reel, or social cut needing aerial 4K footage of a humpback whale surfacing in open blue water.
Edit role
Use this 7-second shot as a marine wildlife insert, transition beat, or energetic cutaway when a timeline needs the whale's surface contact and the spreading splash as one complete action.

Tags

BUZZARDS EAST CAPE LOS CABOS BCS MEXICO2022humpbackwhaleoceanwatersurfacingsplashingmovementblueseamarineanimalwildlifeswimmingspraywavesopen wateraquaticnatural

Shot slate

Resolution
4K UHD
Duration
7s
Codec
H.264 MP4
Location
Buzzards East Cape Los Cabos, Baja California Sur, Mexico
Year filmed
2022
Published
Jan 2022

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A humpback whale surfaces in blue open water near Buzzards Beach, East Cape, Baja California Sur, with white foam trailing above it and no visible people.
The opening frame shows the whale just below and at the surface as the surrounding wake begins to spread. (0:00)
Whale head and back visible below a patch of white ocean foam.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.