Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Humpback Whale Emerging From Ocean Surface (Buzzards East Cape los Cabos, 2022)

7s 4K UHD 29.97fps Wildlife Buzzards East Cape los Cabos, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A humpback whale surfaces in the open ocean, creating splashes and water movement. The whale's head and body emerge from the blue water, with spray and waves visible. The sequence captures the animal's motion as it interacts with the ocean surface.

Clip Intelligence

Production use
Fits wildlife documentary, Baja California Sur travel edit, conservation segment, agency mood reel, or social cut needing aerial 4K footage of a humpback whale surfacing in open blue water.
Edit role
Use this 7-second shot as a marine wildlife insert, transition beat, or energetic cutaway when a timeline needs the whale's surface contact and the spreading splash as one complete action.
Visual details
A humpback whale breaks the blue ocean surface under bright overhead light, with white foam, spray, and turquoise water around its head and body, and no people visible.
Shot mechanics
The frames read as an overhead aerial composition consistent with the DJI drone hint, keeping the whale in the lower and middle portions of the frame while white surface wash expands across open water.

Tags

humpbackwhaleoceanwatersurfacingsplashingmovementblueseamarineanimalwildlifeswimmingspraywavesopen wateraquaticnatural

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
7s
Codec
H.264 MP4
File size
87 MB
Location
Buzzards East Cape Los Cabos, Baja California Sur, Mexico
Year filmed
2022
Published
Jan 2022

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

A humpback whale surfaces in blue open water near Buzzards Beach, East Cape, Baja California Sur, with white foam trailing above it and no visible people.
The opening frame shows the whale just below and at the surface as the surrounding wake begins to spread. (0:00)
The humpback whale remains near the surface in blue water at Buzzards Beach, East Cape, Baja California Sur, with a bright patch of foam above its head and no visible people.
This frame gives editors a clear overhead view of the whale positioned under the broken white surface water. (0:01)
A diagonal overhead view shows the humpback whale at the surface in open blue water near Buzzards Beach, East Cape, Baja California Sur, with foamy wash above and no visible people.
The whale is still readable beneath the surface as the whitewater shifts across the top of the frame. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.