Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN PANCHO NAYARIT MEXICO-2022: Hikers Moving Along a Narrow Forest Trail

6s 4K UHD Mexico 2022
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A group of people, including adults and a child, walk along a narrow forest trail. The path is surrounded by dense greenery and ferns. They move forward through the natural, sun-dappled environment.

Clip Intelligence

Production use
Useful for a travel edit, documentary, brand film, or social cut needing adults and a child hiking through a green forest trail in San Pancho Nayarit Mexico.
Edit role
The six-second clip works as a movement cutaway, transition beat, or trail insert between broader beach, forest, or travel sequence shots.

Tags

SAN PANCHO NAYARIT MEXICO2022foresttrailhikingpeopleadultschildgreeneryfernsdirtpathwalkingbackpackheadscarfhatnaturaloutdoorgroupmovement

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Adults and a child move away on a narrow dirt forest trail in San Pancho Nayarit Mexico, with a straw hat, teal backpack, blonde headscarf, palms, and bright sun patches visible.
This opening frame places the viewer close behind the hikers as they enter the shaded trail. (0:00)
Small group continuing along a shaded dirt path.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.