Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Hikers Moving Along a Narrow Forest Trail (San Pancho Nayarit, 2022)

6s 4K UHD 59.96fps Forest San Pancho, Mexico 2022
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A group of people, including adults and a child, walk along a narrow forest trail. The path is surrounded by dense greenery and ferns. They move forward through the natural, sun-dappled environment.

Clip Intelligence

Production use
Useful for a travel edit, documentary, brand film, or social cut needing adults and a child hiking through a green forest trail in San Pancho Nayarit Mexico.
Edit role
The six-second clip works as a movement cutaway, transition beat, or trail insert between broader beach, forest, or travel sequence shots.
Visual details
Adults and a child walk away along a narrow dirt path, with a straw hat, teal backpack, blonde headscarf, dense ferns, dry leaf litter, exposed earth banks, and bright sun patches visible.
Shot mechanics
The composition sits close behind the hikers, with foreground shoulders and heads entering frame, the group in the midground, and the winding dirt trail and shaded vegetation ahead.

Tags

foresttrailhikingpeopleadultschildgreeneryfernsdirtpathwalkingbackpackheadscarfhatnaturaloutdoorgroupmovement

Shot slate

Resolution
3840 × 2160
Frame rate
59.96 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
39 MB
Location
Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Adults and a child move away on a narrow dirt forest trail in San Pancho Nayarit Mexico, with a straw hat, teal backpack, blonde headscarf, palms, and bright sun patches visible.
This opening frame places the viewer close behind the hikers as they enter the shaded trail. (0:00)
The hikers continue deeper along the San Pancho Nayarit Mexico forest path, with the child in a pale shirt ahead and large green fronds framing the upper edge.
This frame shows forward progress along the enclosed dirt path with foliage tight on both sides. (0:01)
The group is farther ahead on the San Pancho Nayarit Mexico trail, with the blonde headscarf close to camera and a sunlit curve in the dirt path visible through dense greenery.
This moment emphasizes the winding route and the layered foreground heads and midground hikers. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.