Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Jazz Dance Group Performing Synchronized Routines (San Jose del Cabo, 2023)

6s 4K UHD 29.97fps People San Jose del Cabo, Mexico 2023
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A group of children in matching 'Jazz Dance' shirts perform synchronized dance routines. The stage is lit with changing neon colors, including purple, green, and pink. The dancers move in unison, executing coordinated arm and body movements.

Clip Intelligence

Production use
Fits a travel edit, documentary, school arts segment, agency mood reel, or social cut needing children performing a jazz dance routine in Mexico under bright stage lighting.
Edit role
Use this six-second clip as a quick performance insert, rhythmic cutaway, or energetic beat between broader San Jose del Cabo 2023 sequence material.
Visual details
Children in black Jazz Dance shirts perform on an indoor stage with dark background panels, glossy floor reflections, and shifting purple, green, pink, and cyan light.
Shot mechanics
Ground-camera stage coverage frames the dancers mostly in the midground, with some foreground audience or stage shadow occlusion at the lower right in several frames.

Tags

kidsdancersjazzdancegroupstageindoordancingperformingsynchronizedmovingneonpurplegreenpinkenergeticlivelyperformance

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
63 MB
Location
Mexico
Year filmed
2023
Published
Jun 2026

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Children in black Jazz Dance shirts perform on an indoor stage in San Jose del Cabo BCS Mexico, with one dancer raising an arm as purple and green light crosses the group.
This opening frame shows the group arranged across the stage as the routine begins under mixed neon lighting. (0:00)
The children shift into a tighter cluster on the San Jose del Cabo BCS Mexico stage, with several faces turned toward the audience and purple light filling the background.
This frame captures the group changing positions during the synchronized routine. (0:01)
Children in matching Jazz Dance shirts face each other on the indoor stage in San Jose del Cabo BCS Mexico, with green and pink highlights catching their hands and hair.
This moment emphasizes face-level hand gestures and side-facing choreography. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.