Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN JOSE DEL CABO BCS MEXICO-2023: Jazz Dance Group Performing Synchronized Routines

6s 4K UHD Mexico 2023
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

A group of children in matching 'Jazz Dance' shirts perform synchronized dance routines. The stage is lit with changing neon colors, including purple, green, and pink. The dancers move in unison, executing coordinated arm and body movements.

Clip Intelligence

Production use
Fits a travel edit, documentary, school arts segment, agency mood reel, or social cut needing children performing a jazz dance routine in Mexico under bright stage lighting.
Edit role
Use this six-second clip as a quick performance insert, rhythmic cutaway, or energetic beat between broader San Jose del Cabo 2023 sequence material.

Tags

SAN JOSE DEL CABO BCS MEXICO2023kidsdancersjazzdancegroupstageindoordancingperformingsynchronizedmovingneonpurplegreenpinkenergeticlivelyperformance

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Mexico
Year filmed
2023
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Children in black Jazz Dance shirts perform on an indoor stage in San Jose del Cabo BCS Mexico, with one dancer raising an arm as purple and green light crosses the group.
This opening frame shows the group arranged across the stage as the routine begins under mixed neon lighting. (0:00)
Dance group clustered on stage in purple lighting.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.