Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

MALIBU CALIFORNIA-2020: The Wind Making Tall Palms On A Beach Swing Their Leaves

5s 4K UHD Malibu, California, United States 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The natural motion of the palms creates a peaceful, cinematic atmosphere, evoking summer relaxation and coastal beauty. Ideal for travel, lifestyle, or nature-themed content.

Clip Intelligence

Production use
Travel editors, documentary teams, agency mood reels, brand films, and social cuts can use this Malibu coastal view for a sunny beach atmosphere built around wind moving tall palms above the water.
Edit role
Use this short clip as a breezy cutaway, transition beat, or opener texture between beach campsite, ocean background, and palm-tree shots in a Malibu sequence.
Visual details
Tall palms fill the foreground and midground, the blue sea and straight horizon sit behind them, bright daylight hits the fronds, and no people are visible in the frames.

Tags

palm treetreesbeachseawindmakingtallpalmsswingleavesnaturemalibu california2020stunningloveemotioninspirationcamerabuycurrent

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Malibu, California, United States
Year filmed
2020
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Tall palm trees stand above a Malibu shoreline with blue ocean and a level horizon behind them, with no visible people.
The opening frame shows the coastal palm composition with ocean filling the background. (0:00)
A central tall palm rises above smaller palms along the Malibu coast, with bright sky and textured blue water behind it and no visible people.
This frame captures the tall central palm against the water as the fronds shift in the breeze. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.