Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

MALIBU CALIFORNIA-2019: Time Lapse Shows Trees Blowing In The Wind

5s 4K UHD Malibu, California, United States 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A serene 2019 time-lapse from Malibu, California captures trees swaying vigorously in the wind against a dynamic sky. The footage evokes calm and motion, ideal for cinematic backdrops, nature montages, or ambient transitions.

Clip Intelligence

Production use
Useful for travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing Malibu nature atmosphere with palms, ocean, and sunset light.
Edit role
Works as a short opener, transition, ambient cutaway, or closing beat between road, traffic, and coastal lifestyle scenes in a Malibu sequence.

Tags

treeseawindskyactivitytimelapsetreesblowingnaturemalibu california2019artbuyfootageabstractdigitalstock videomodern

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Malibu, California, United States
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Malibu, California coastal view at the start of the clip, with a large palm at right, smaller palms near the road, ocean on the horizon, and no visible people.
The opening frame sets the Malibu coast with palms, parked vehicles, and low evening sun near the horizon. (0:00)
Sun flares through a large palm above a coastal road and ocean.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.