Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Time Lapse Shows Trees Blowing In The Wind (Malibu, 2019)

5s 4K UHD 29.97fps Nature Malibu, California, United States 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A serene 2019 time-lapse from Malibu, California captures trees swaying vigorously in the wind against a dynamic sky. The footage evokes calm and motion, ideal for cinematic backdrops, nature montages, or ambient transitions.

Clip Intelligence

Production use
Useful for travel edits, coastal documentary sequences, agency mood reels, brand films, and social cuts needing Malibu nature atmosphere with palms, ocean, and sunset light.
Edit role
Works as a short opener, transition, ambient cutaway, or closing beat between road, traffic, and coastal lifestyle scenes in a Malibu sequence.
Visual details
An elevated view looks past palms, shrubs, parked vehicles, small buildings, and a road toward the ocean horizon, with the low sun flaring through a large palm and no visible people.
Shot mechanics
The frames show a wide elevated composition with foreground hillside vegetation, midground palms and coastal buildings, and a level ocean horizon under changing time-lapse light.

Tags

treeseawindskyactivitytimelapsetreesblowingnaturemalibu californiaartbuyfootageabstractdigitalstock videomodern

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MP4
File size
70 MB
Location
Malibu, California, United States
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Malibu, California coastal view at the start of the clip, with a large palm at right, smaller palms near the road, ocean on the horizon, and no visible people.
The opening frame sets the Malibu coast with palms, parked vehicles, and low evening sun near the horizon. (0:00)
Malibu, California frame with the sun partly hidden by a tall palm, warm light across hillside vegetation, ocean in the background, and no visible people.
This second captures the sun breaking through the palm canopy over the coastal neighborhood below. (0:01)
Malibu, California view with a broad sky, dark palm silhouettes, clustered roadside buildings, distant ocean, and no visible people.
The frame emphasizes the contrast between the bright sky, silhouetted palms, and the coastal road below. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.