Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

EAST CAPE BCS MEXICO-2019: Weird Irregular Shape or Pattern in the Ocean Shaky

5s 4K UHD Baja California Sur, Mexico 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The shaky, handheld camera work adds to the eerie, unexplained nature of the scene.

Clip Intelligence

Production use
Useful for documentary, travel edit, agency mood reel, brand film, or social cut needing a 2019 Baja California Sur ocean surface with an unusual pale pattern in open water.
Edit role
At about five seconds, this works as a brief insert, texture beat, or uneasy transition between wider East Cape ocean shots and wildlife or water detail in the same sequence.

Tags

creepywavesshotcameraweirdunknownirregularshapepatternoceanshakyfilmanimalswildlifeeast cape BCS mexico DJIeastbusinesscurrentstunningpretty

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Baja California Sur, Mexico
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Blue green ocean surface in Baja California Sur, Mexico with a faint pale irregular pattern near the center and no visible people.
The opening frame presents the unexplained surface pattern as a subtle mark in open water. (0:00)
Rippling ocean water with light-toned current shape

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.