Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN JOSE DEL CABO MEXICO-2019: Two Teams of Kids Begin an Infield Play of Soccer

6s 4K UHD 29.97fps San Jose Del Cabo, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

Two teams of children compete in a lively soccer match on a grassy field in San Jose del Cabo, Mexico, in 2019. Shot on home movie film, this candid footage captures the energy and joy of kids playing sports outdoors. The natural lighting and handheld camera style give it an authentic, nostalgic feel. Ideal for projects exploring youth, community, or outdoor recreation in a tropical setting.

Clip Intelligence

Production use
Fits documentary, travel edit, education piece, brand film, or social cut needing real children playing soccer outdoors in San Jose del Cabo, Mexico.
Edit role
Works as a short cutaway or action beat inside a youth sports sequence, showing kids clustering around the ball near the sideline and goal area.
Visual details
Children in white and bright green soccer kits move across a grass field, with a dirt sideline, white goal, coach-like adults, trees, a stone wall, and dry hills in hard midday light.

Tags

grasschildrenballsoccerfieldplayingteamskidsplaypeopleSAN jose DEL cabo mexico C2019stock videoamateurdigitalcinematicabstract

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
72 MB
Location
San Jose Del Cabo, Mexico
Year filmed
2019
Published
Jun 2019

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Children in white and green soccer uniforms spread across a grass field in San Jose del Cabo, Mexico, with a white goal, trees, stone wall, and hillside behind them.
This opening frame shows the youth soccer play forming near the sideline and goal area. (0:00)
Several children in white and green kits converge around the soccer ball on the grass field in San Jose del Cabo, with the goal and shaded trees in the background.
This frame captures the cluster of players as the ball moves through the middle of the play. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.