Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

CABO SAN LUCAS MEXICO-2019: Children Soccer Ages - Years Of Age Supervised

6s 4K UHD 29.97fps Cabo San Lucas, Mexico 2019
People appear in this clip. Editorial use is cleared as shot. If a recognizable person is used commercially, a model release is the licensee's responsibility. how releases work.

About this clip

Children play soccer in a supervised summertime activity in Cabo San Lucas, Mexico,. The clip shows kids of various ages engaged in healthy recreation, emphasizing teamwork, sound decision-making, and building character through sports. This authentic home video footage offers a nostalgic glimpse into youth recreation in a tropical resort setting. Ideal for documentaries, educational content, or nostalgic storytelling about childhood development and community activities.

Clip Intelligence

Production use
Useful for documentary, education, travel edit, brand film, or social cut needing supervised children's soccer activity in Cabo San Lucas, Mexico, with an adult coach and young players visible.
Edit role
Best as a short cutaway or insert within a youth sports, family travel, or community recreation sequence, showing the group near the goal between active play moments.
Visual details
Young children in green soccer jerseys gather and move on a bright grass field while an adult coach in a green shirt stands near a white goal, with a stone wall and chain-link fence behind them.

Tags

health and wellbeingbuilding characterteam worksound decision makingchildrensocceragesyearsagesupervisedsummertimeactivitieshealthykidssportsrecreationcabo SAN lucas mexico C2019digital

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.264 MP4
File size
71 MB
Location
Cabo San Lucas, Mexico
Year filmed
2019
Published
May 2019

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Children in green soccer shirts move across a grass field in Cabo San Lucas, Mexico, while an adult coach stands near a white goal in the distance.
The opening frame sets up a supervised children's soccer activity on a sunny grass field. (0:00)
Young players in green jerseys run and walk toward an adult coach standing near the goal on a Cabo San Lucas soccer field.
This frame shows the children converging toward the coach and goal area. (0:01)
Children in soccer jerseys gather near a coach by the goal.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.