Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

Highway traffic in Malibu, California, United States, 2019

5s 4K UHD Malibu, California, United States 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The footage showcases multiple vehicles racing along the coastal highway, evoking a sense of freedom and motion. Ideal for documentaries, travel montages, or editorial content exploring speed, movement, and American road life.

Clip Intelligence

Production use
Use this Malibu highway traffic clip for road travel edits, documentary passages about California transportation, agency mood reels, brand films, or social cuts needing modern freeway movement in bright daylight.
Edit role
The short runtime works best as a quick transition, driving cutaway, road insert, or pace-setting beat between wider Malibu travel or transportation scenes.

Tags

speedautostreetsspeedwayracecarsdrivinghighwayfasttransportationmalibu california2019stock videocinematicbusinessabstractvideography4kmodern

Shot slate

Resolution
4K UHD
Duration
5s
Codec
H.264 MP4
Location
Malibu, California, United States
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Malibu highway view partly covered by a dark overpass shadow, with lane markings, roadside trees, blue sky, and no visible people.
This opening frame gives an underpass-shadow transition into the freeway traffic sequence. (0:00)
Roadway emerging from heavy bridge shadow with trees and freeway lanes ahead.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.