Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Highway traffic in Malibu, California, United States, 2019 · clip 3 of 7

5s 4K UHD 29.97fps Road Malibu, California, United States 2019
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The footage showcases multiple vehicles racing along the coastal highway, evoking a sense of freedom and motion. Ideal for documentaries, travel montages, or editorial content exploring speed, movement, and American road life.

Clip Intelligence

Production use
Use this Malibu highway traffic clip for road travel edits, documentary passages about California transportation, agency mood reels, brand films, or social cuts needing modern freeway movement in bright daylight.
Edit role
The short runtime works best as a quick transition, driving cutaway, road insert, or pace-setting beat between wider Malibu travel or transportation scenes.
Visual details
Frames show a multi-lane highway with cars passing, concrete barriers, overpass shadows, roadside trees, power structures, distant buildings, blue sky, hard midday sun, and no visible people.
Shot mechanics
The composition sits low over or near the roadway with lane markings in the foreground, traffic in the midground, a steady horizon, and no clear drone perspective confirmed from the frames.

Tags

speedautostreetsspeedwayracecarsdrivinghighwayfasttransportationmalibu californiastock videocinematicbusinessabstractvideography4kmodern

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MP4
File size
85 MB
Location
Malibu, California, United States
Year filmed
2019
Published
Jun 2026

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Malibu highway view partly covered by a dark overpass shadow, with lane markings, roadside trees, blue sky, and no visible people.
This opening frame gives an underpass-shadow transition into the freeway traffic sequence. (0:00)
Malibu highway frame still dominated by overpass shadow, with the open roadway ahead, trees along the side, and no visible people.
The frame holds the dark-to-bright roadway contrast as the clip moves through the freeway corridor. (0:01)
Bright Malibu highway scene with two cars ahead, a concrete median barrier, roadside trees, a power tower, blue sky, and no visible people.
This frame shows the clip opening into direct sun with vehicles moving along the highway. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.