Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

DENVER COLORADO-2016: Aerial View Of A Dark City Landscape With No Light

5s 4K UHD 29.97fps Denver, Colorado, United States 2016
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

Aerial view of Denver, Colorado in 2016, capturing a dark cityscape at night with scattered lights illuminating buildings and urban infrastructure. The footage showcases a moody, cinematic atmosphere with a modern city skyline under a deep night sky. This home movie clip offers a nostalgic, intimate glimpse of urban life in the 2010s. The quiet, contemplative mood makes it ideal for documentaries, editorial content, or creative projects exploring cityscapes, architecture, or nighttime ambiance.

Clip Intelligence

Production use
Fits a Denver night sequence for a documentary, travel edit, agency mood reel, brand film, or social cut that needs a dark aerial city landscape with distant urban lights.
Edit role
Works as a short nighttime opener, transition, or atmospheric texture between brighter Denver street, mall, park, or family scenes in the same 2016 collection.
Visual details
The frames show a very dark aerial view with a low horizon of scattered city lights, isolated amber streetlights below, black foreground terrain, and no visible people.

Tags

scenedarkcitylandscapeaerialviewlightbuildingslandmarksdenver colorado2016videographyhome videostunningbusinessabstract

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
5s
Codec
H.264 MOV
File size
40 MB
Location
Denver, Colorado, United States
Year filmed
2016
Published
Nov 2016

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Denver, Colorado night aerial frame showing a mostly black foreground, scattered city lights on the horizon, a few amber lights below, and no visible people.
The opening frame establishes the dark Denver night setting with only distant urban lights visible. (0:00)
Denver, Colorado aerial view at night with a broad dark foreground, a thin band of urban lights in the distance, and no visible people.
This frame keeps the city lights distant, giving the clip a sparse night texture for an edit. (0:01)
Dark aerial cityscape with brighter lights clustered near the horizon.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.