Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

SAN JOSE DEL CABO BCS MEXICO-2020: Cityscape Transitioning From Day to Dusk

6s 4K UHD San Jose Del Cabo, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

An aerial view of a city with residential buildings, a green field, and distant mountains. The sky gradually darkens as the sun sets, casting longer shadows across the landscape. The lighting transitions from bright daylight to dimmer evening conditions over the sequence.

Clip Intelligence

Production use
Aerial cityscape clip for travel edits, documentary context, agency mood reels, brand films, or social cuts needing San Jose Del Cabo residential development with green space and mountains.
Edit role
Use this short aerial view as an opener, location cutaway, or time-of-day transition between daytime activity and evening material in a Mexico travel or documentary timeline.

Tags

SAN JOSE DEL CABO BCS MEXICO2020citybuildingslandscapeskysunsetduskaerialviewurbangreenfieldmountainsshadowslightingchangetime-lapsedayevening

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
San Jose Del Cabo, Baja California Sur, Mexico
Year filmed
2020
Published
Nov 2020

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial frame over San Jose Del Cabo, Mexico, showing residential blocks, a green field in the foreground, dry hills, distant mountains, and no visible people.
The first frame sets the clip with a broad city overview and mountain backdrop. (0:00)
Aerial cityscape with low buildings, hillside housing, green open space, and distant mountains.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.