Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Cityscape Transitioning From Day to Dusk (San Jose del Cabo, 2020)

6s 4K UHD 29.97fps Aerial San Jose del Cabo, Baja California Sur, Mexico 2020
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

An aerial view of a city with residential buildings, a green field, and distant mountains. The sky gradually darkens as the sun sets, casting longer shadows across the landscape. The lighting transitions from bright daylight to dimmer evening conditions over the sequence.

Clip Intelligence

Production use
Aerial cityscape clip for travel edits, documentary context, agency mood reels, brand films, or social cuts needing San Jose Del Cabo residential development with green space and mountains.
Edit role
Use this short aerial view as an opener, location cutaway, or time-of-day transition between daytime activity and evening material in a Mexico travel or documentary timeline.
Visual details
The frames show a wide residential cityscape with low buildings, hillside roads, a green field or golf-like fairway in the foreground, hazy mountains in the distance, blue sky, and no visible people.
Shot mechanics
The composition is a high drone-style aerial view with foreground green space and hillside housing, a dense urban midground, and a level horizon backed by mountains.

Tags

citybuildingslandscapeskysunsetduskaerialviewurbangreenfieldmountainsshadowslightingchangetime-lapsedayevening

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
75 MB
Location
San Jose Del Cabo, Baja California Sur, Mexico
Year filmed
2020
Published
Nov 2020

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial frame over San Jose Del Cabo, Mexico, showing residential blocks, a green field in the foreground, dry hills, distant mountains, and no visible people.
The first frame sets the clip with a broad city overview and mountain backdrop. (0:00)
Second aerial frame over San Jose Del Cabo, Mexico, with the green foreground field and hillside homes leading into a dense low-rise city and hazy mountains, with no visible people.
This moment keeps the same broad composition for use as a steady location cutaway. (0:01)
Third frame of the San Jose Del Cabo aerial view shows clustered residential buildings, a fairway-like green area in front, dry hills at left, mountains on the horizon, and no visible people.
The frame emphasizes the mix of residential development, green space, and dry terrain. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.