Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Boat Moving on a Canal with Road and Mountains (Mulege, 2022)

6s 4K UHD 29.97fps Aerial Mulege, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A boat moves along a narrow waterway, creating ripples in the blue water. A vehicle travels along the adjacent road. The scene includes palm trees, houses, and distant mountains under a clear sky.

Clip Intelligence

Production use
Useful for travel edits, Baja California Sur documentary segments, agency mood reels, brand films, and social cuts needing an aerial view of a boat moving through Mulege with road, palms, homes, and mountains.
Edit role
A six-second aerial cutaway or transition beat that can bridge a waterfront sequence, introduce a canal-side road, or give an editor a quiet movement moment between closer ground-level Mulege scenes.
Visual details
A small white boat crosses blue water and leaves a V-shaped wake, with a road and green shoreline on the right, palm trees and houses on the left, dry mountains in the background, bright daytime light, and no visible people.
Shot mechanics
The frames support an elevated drone composition with water filling the foreground, road and palms in the midground, mountains along the horizon, and the boat's wake providing the clearest motion cue.

Tags

boatwatercanalroadmountainspalmtreeshousesripplesmovingaerialbluegreenvehiclelandscapecalmdaytimelake

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
74 MB
Location
Mulege, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view in Mulege, Baja California Sur, with a small white boat moving across blue canal water, a road on the right, palm-lined houses on the left, dry mountains beyond, and no visible people.
The opening frame shows the canal layout, with the boat wake beginning to cut across the water between homes and roadside shoreline. (0:00)
One second into the Mulege aerial view, the white boat sits farther along the blue waterway with a widening V-shaped wake, roadside shoreline to the right, palms and houses to the left, and no visible people.
This frame emphasizes the boat's movement and the clean wake pattern against the canal surface. (0:01)
Midway through the aerial pass in Mulege, the boat is visible near the center-right of the canal, its wake trailing over dark blue water, with homes, palms, a pale road, dry hills, and no visible people.
The frame gives editors a balanced view of water movement, settlement edge, roadside, and surrounding hills. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.