Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

MULEGE BCS MEXICO-2022: Boat Moving on a Canal with Road and Mountains

6s 4K UHD Mulege, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A boat moves along a narrow waterway, creating ripples in the blue water. A vehicle travels along the adjacent road. The scene includes palm trees, houses, and distant mountains under a clear sky.

Clip Intelligence

Production use
Useful for travel edits, Baja California Sur documentary segments, agency mood reels, brand films, and social cuts needing an aerial view of a boat moving through Mulege with road, palms, homes, and mountains.
Edit role
A six-second aerial cutaway or transition beat that can bridge a waterfront sequence, introduce a canal-side road, or give an editor a quiet movement moment between closer ground-level Mulege scenes.

Tags

MULEGE BCS MEXICO2022boatwatercanalroadmountainspalmtreeshousesripplesmovingaerialbluegreenvehiclelandscapecalmdaytimelake

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Mulege, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial view in Mulege, Baja California Sur, with a small white boat moving across blue canal water, a road on the right, palm-lined houses on the left, dry mountains beyond, and no visible people.
The opening frame shows the canal layout, with the boat wake beginning to cut across the water between homes and roadside shoreline. (0:00)
Boat wake spreads across blue water near a road, palms, houses, and mountains.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.