Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

LA BOCANA BCS MEXICO-2022: Desert Coastline with Ocean Waves and Arid Terrain

8s 4K UHD La Bocana, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The video captures a desert coastline where the ocean meets dry, sandy terrain. Gentle waves roll onto the shore while the arid desert extends inland with sparse vegetation. Scattered clouds in the sky shift slightly across the sequence.

Clip Intelligence

Production use
Aerial desert coastline footage for travel edits, Baja California Sur documentary segments, agency mood reels, brand films, and social cuts needing ocean surf beside dry coastal terrain.
Edit role
Use this 8-second clip as a wide opener, geography transition, or quiet cutaway between closer beach details in a La Bocana or Baja California Sur sequence.

Tags

LA BOCANA BCS MEXICO2022desertoceancoastlinebeachsandwavesaridlandscapeaerialskycloudsbluebrownhorizonshorewaterdrynatural

Shot slate

Resolution
4K UHD
Duration
8s
Codec
H.264 MP4
Location
La Bocana, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial frame over La Bocana, Baja California Sur with turquoise ocean on the left, white surf tracing a sandy beach, brown desert terrain to the right, distant hazy hills, and no visible people.
The opening frame establishes the coastline where surf meets dry terrain. (0:00)
Wide aerial coastline with waves and arid inland plain

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.