Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Desert Coastline with Ocean Waves and Arid Terrain (La Bocana, 2022)

8s 4K UHD 29.97fps Desert La Bocana, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

The video captures a desert coastline where the ocean meets dry, sandy terrain. Gentle waves roll onto the shore while the arid desert extends inland with sparse vegetation. Scattered clouds in the sky shift slightly across the sequence.

Clip Intelligence

Production use
Aerial desert coastline footage for travel edits, Baja California Sur documentary segments, agency mood reels, brand films, and social cuts needing ocean surf beside dry coastal terrain.
Edit role
Use this 8-second clip as a wide opener, geography transition, or quiet cutaway between closer beach details in a La Bocana or Baja California Sur sequence.
Visual details
Turquoise ocean fills the left side, white surf lines the sandy beach, brown arid terrain with sparse scrub and dirt tracks stretches inland, hazy mountains sit on the horizon, and no people are visible.
Shot mechanics
High aerial composition consistent with drone capture, with ocean in the left foreground and midground, beach forming a diagonal shoreline, desert plain to the right, and a wide level horizon in the background.

Tags

desertoceancoastlinebeachsandwavesaridlandscapeaerialskycloudsbluebrownhorizonshorewaterdrynatural

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
8s
Codec
H.265 (HEVC) MP4
File size
100 MB
Location
La Bocana, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

3 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial frame over La Bocana, Baja California Sur with turquoise ocean on the left, white surf tracing a sandy beach, brown desert terrain to the right, distant hazy hills, and no visible people.
The opening frame establishes the coastline where surf meets dry terrain. (0:00)
A wide aerial view of La Bocana shows the shoreline running diagonally through the frame, ocean water on the left, scrubby desert plain on the right, pale sky haze near the horizon, and no visible people.
This frame keeps the coast and inland desert in one broad geography view. (0:01)
The La Bocana coastline remains centered with white wave bands along the beach, open turquoise water at left, faint dirt roads crossing the brown desert inland, distant mountains, and no visible people.
The frame highlights the usable contrast between coastal water and undeveloped inland desert. (0:02)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.