Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

GUERRERO NEGRO BCS MEXICO-2022: Arid Desert and Blue Water Body From Above

6s 4K UHD Guerrero Negro, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

An aerial view captures the transition from arid desert terrain to a large blue water body. The camera moves slowly, showing the contrast between the brown, dry land and the white salt flat along the water's edge. The sky is clear with scattered clouds, and the water remains calm throughout the sequence.

Clip Intelligence

Production use
Fits a documentary, travel edit, agency mood reel, or brand film needing a 4K aerial view of Guerrero Negro desert terrain meeting blue water and white salt flat.

Tags

GUERRERO NEGRO BCS MEXICO2022desertwaterbluesandaridlandscapeaerialviewdrylakeshoreterrainskycloudsbrownwhitesalt flatoasis

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Guerrero Negro, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

One frame exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.