Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

GUERRERO NEGRO BCS MEXICO-2022: Arid Desert and Blue Water Body From Above

6s 4K UHD Guerrero Negro, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

An aerial view captures the transition from arid desert terrain to a large blue water body. The camera moves slowly, showing the contrast between the brown, dry land and the white salt flat along the water's edge. The sky is clear with scattered clouds, and the water remains calm throughout the sequence.

Clip Intelligence

Production use
Fits a documentary, travel edit, agency mood reel, or brand film needing a 4K aerial view of Guerrero Negro desert terrain meeting blue water and white salt flat.
Edit role
Use as a six-second opener, transition, or geographic cutaway between ground-level Guerrero Negro scenes and wider environmental context.
Visual details
The frames show brown arid land in the foreground, a broad white salt flat along the shore, calm blue water beyond it, pale sky with light clouds, and no visible people.

Tags

GUERRERO NEGRO BCS MEXICO2022desertwaterbluesandaridlandscapeaerialviewdrylakeshoreterrainskycloudsbrownwhitesalt flatoasis

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
Guerrero Negro, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial view over Guerrero Negro, Baja California Sur, with brown desert in front, a white salt flat at the shoreline, blue water beyond, and no visible people.
The first frame sets the wide desert-to-water contrast that defines the clip. (0:00)
Aerial frame over Guerrero Negro showing more of the white salt flat across the midground, rust-brown land in the foreground, calm blue water in the background, and no visible people.
This moment emphasizes the bright salt flat separating the dry terrain from the water. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.