Low-resolution preview (256x144) for evaluation. The licensed download is the clean 4K UHD master at the stated resolution.

Download the free low-res preview to test in your edit

Arid Desert and Blue Water Body From Above (Guerrero Negro, 2022)

6s 4K UHD 29.97fps Desert Guerrero Negro, Baja California Sur, Mexico 2022
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

An aerial view captures the transition from arid desert terrain to a large blue water body. The camera moves slowly, showing the contrast between the brown, dry land and the white salt flat along the water's edge. The sky is clear with scattered clouds, and the water remains calm throughout the sequence.

Clip Intelligence

Production use
Fits a documentary, travel edit, agency mood reel, or brand film needing a 4K aerial view of Guerrero Negro desert terrain meeting blue water and white salt flat.
Edit role
Use as a six-second opener, transition, or geographic cutaway between ground-level Guerrero Negro scenes and wider environmental context.
Visual details
The frames show brown arid land in the foreground, a broad white salt flat along the shore, calm blue water beyond it, pale sky with light clouds, and no visible people.
Shot mechanics
A high aerial composition holds the desert in the foreground, salt flat and shoreline in the midground, and blue water with a flat horizon in the background.

Tags

desertwaterbluesandaridlandscapeaerialviewdrylakeshoreterrainskycloudsbrownwhitesalt flatoasis

Shot slate

Resolution
3840 × 2160
Frame rate
29.97 fps
Duration
6s
Codec
H.265 (HEVC) MP4
File size
75 MB
Location
Guerrero Negro, Baja California Sur, Mexico
Year filmed
2022
Published
Jun 2026

Still Frames From This Clip

4 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Opening aerial view over Guerrero Negro, Baja California Sur, with brown desert in front, a white salt flat at the shoreline, blue water beyond, and no visible people.
The first frame sets the wide desert-to-water contrast that defines the clip. (0:00)
Aerial frame over Guerrero Negro showing more of the white salt flat across the midground, rust-brown land in the foreground, calm blue water in the background, and no visible people.
This moment emphasizes the bright salt flat separating the dry terrain from the water. (0:01)
Wide aerial view in Guerrero Negro with the shoreline curving around blue water, pale salt flats across the center, dry brown land below, and no visible people.
The frame shows the shoreline curve and broad white mineral surface from above. (0:02)
Mid-clip aerial frame over Guerrero Negro showing brown desert foreground, pale salt flat near the water, blue bay-like water, distant low mountains, and no visible people.
This frame adds distant landforms along the horizon while keeping the salt flat and water central. (0:03)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.