Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

Distant Fire and Black Smoke Over Urban Area at Dusk

6s 4K UHD San Jose Del Cabo, Baja California Sur, Mexico 2023
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A large fire with thick black smoke rises over an urban area at dusk. The city below is illuminated by scattered lights, with the fire's glow visible in the distance. The sequence shows the fire and smoke remaining prominent while city lights subtly change.

Clip Intelligence

Production use
Aerial dusk footage of a large urban fire in San Jose Del Cabo suits documentary, news-adjacent, emergency planning, climate risk, agency mood reel, or social edits needing real city fire imagery.
Edit role
Use this six-second clip as a tense cutaway, incident insert, transition beat, or short opener before closer ground-level context in a timeline about urban risk or emergency response.

Tags

1909firesmokeblack smokecityurbandusknightlightsflamesaerialeveningdarkcityscapeburningemergencyfire emergencycity lightssmoke plumedrone

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
San Jose Del Cabo, Baja California Sur, Mexico
Year filmed
2023
Published
Jun 2026

Still Frames From This Clip

2 frames exported from the 4K master of this clip, in timeline order. The licensed download is the full-motion master, not these stills.

Aerial dusk view over San Jose Del Cabo with city lights below, orange flames in the distance, a black smoke plume rising, and no visible people.
The opening frame places the fire beyond the illuminated urban foreground as dusk light fades behind the hills. (0:00)
Aerial view over San Jose Del Cabo at dusk with the fire glowing near the center, scattered street lights below, hills on the horizon, and no visible people.
This frame keeps the fire centered while the thick smoke column rises above the city grid. (0:01)

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.