Preview is a low-resolution watermarked version. Licensed download is a clean 4K UHD master. Download free watermarked preview to test in your edit

Distant Fire and Black Smoke Over Urban Area at Dusk

6s 4K UHD San Jose Del Cabo, Baja California Sur, Mexico 2023
No people visible. No identifiable people are visible in this clip. Commercial clearance still depends on the final use and any property shown.

About this clip

A large fire with thick black smoke rises over an urban area at dusk. The city below is illuminated by scattered lights, with the fire's glow visible in the distance. The sequence shows the fire and smoke remaining prominent while city lights subtly change.

Clip Intelligence

Production use
Aerial dusk footage of a large urban fire in San Jose Del Cabo suits documentary, news-adjacent, emergency planning, climate risk, agency mood reel, or social edits needing real city fire imagery.

Tags

1909firesmokeblack smokecityurbandusknightlightsflamesaerialeveningdarkcityscapeburningemergencyfire emergencycity lightssmoke plumedrone

Shot slate

Resolution
4K UHD
Duration
6s
Codec
H.264 MP4
Location
San Jose Del Cabo, Baja California Sur, Mexico
Year filmed
2023
Published
Jun 2026

License this clip royalty-free for $79 (Standard: all media, worldwide, perpetual, up to 1M views) or $199 (Extended: unlimited distribution, broadcast TV, theatrical). Instant 4K download with a license PDF, direct from filmmaker Phil Maher.